Details of the Target

General Information of Target

Target ID	LDTP18091
Target Name	Sperm-associated microtubule inner protein 5 (SPMIP5)
Gene Name	SPMIP5
Gene ID	143379
Synonyms	C10orf82; Sperm-associated microtubule inner protein 5
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MEPNSPKKIQFAVPVFQSQIAPEAAEQIRKRRPTPASLVILNEHNPPEIDDKRGPNTQGE LQNASPKQRKQSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRDH
Target Bioclass	Other
Subcellular location	Cytoplasm
Function	Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in flagellum axoneme. May serve to reinforce and thus stabilize the microtubule structure in the sperm flagella.
Uniprot ID	Q8WW14
Ensemble ID	ENST00000369210.7
HGNC ID	HGNC:28500

Target Site Mutations in Different Cell Lines

Cell line	Mutation details	Probe for labeling this protein in this cell
HCT116	SNV: p.A109V	.
MEWO	SNV: p.P103L	.
NCIH2172	SNV: p.I155V	.

Probe(s) Labeling This Target

ABPP Probe

Click To Hide/Show 1 Probe Related to This Target

Probe name		Structure	Binding Site(Ratio)	Interaction ID	Ref
CY4 Probe Info			N.A.	LDD0247	[1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme

Click To Hide/Show 2 Protein(s) Interacting with This Target

Protein name				Family	Uniprot ID
Maspardin (SPG21)				AB hydrolase superfamily	Q9NZD8
Probable E3 ubiquitin-protein ligase makorin-3 (MKRN3)				.	Q13064

Other

Click To Hide/Show 3 Protein(s) Interacting with This Target

Protein name	Family	Uniprot ID
Myozenin-3 (MYOZ3)	Myozenin family	Q8TDC0
Pre-mRNA-splicing factor SPF27 (BCAS2)	SPF27 family	O75934
G-protein-signaling modulator 3 (GPSM3)	.	Q9Y4H4

References

1	Cyclopropenone, Cyclopropeniminium Ion, and Cyclopropenethione as Novel Electrophilic Warheads for Potential Target Discovery of Triple-Negative Breast Cancer. J Med Chem. 2023 Feb 23;66(4):2851-2864. doi: 10.1021/acs.jmedchem.2c01889. Epub 2023 Feb 10.