Details of the Target
General Information of Target
Target ID | LDTP18040 | |||||
---|---|---|---|---|---|---|
Target Name | Putative ribosomal protein uL10-like (RPLP0P6) | |||||
Gene Name | RPLP0P6 | |||||
Synonyms |
Putative ribosomal protein uL10-like; 60S acidic ribosomal protein P0-like; Large ribosomal subunit protein uL10-like |
|||||
3D Structure | ||||||
Sequence |
MDKLTIISGCLFLAADIFAIASIANPDWINTGESAGALTVGLVRQCQTIHGRDRTCIPPR
LPPEWVTTLFFIIMGIISLTVTCGLLVASHWRREATKYARWIAFTGMILFCMAALIFPIG FYINEVGGQPYKLPNNTVVGSSYVLFVLSIFFTIVGLLFAGKVCLPG |
|||||
Target Bioclass |
Other
|
|||||
Family |
Universal ribosomal protein uL10 family
|
|||||
Function | Ribosomal protein P0 is the functional equivalent of E.coli protein L10. | |||||
Uniprot ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
YN-1 Probe Info |
![]() |
100.00 | LDD0444 | [1] | |
AZ-9 Probe Info |
![]() |
E70(1.24); D23(1.02) | LDD2208 | [2] | |
IPM Probe Info |
![]() |
C119(0.00); C27(0.00) | LDD0241 | [3] | |
DBIA Probe Info |
![]() |
C27(5.04) | LDD3312 | [4] | |
AHL-Pu-1 Probe Info |
![]() |
C119(3.08) | LDD0170 | [5] | |
Ox-W18 Probe Info |
![]() |
N.A. | LDD2175 | [6] | |
W1 Probe Info |
![]() |
N.A. | LDD0236 | [3] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0025 | 4SU-RNA | DM93 | C119(3.08) | LDD0170 | [5] |
LDCM0026 | 4SU-RNA+native RNA | DM93 | C119(3.81) | LDD0171 | [5] |
LDCM0020 | ARS-1620 | HCC44 | C27(1.11); C119(1.02) | LDD2171 | [7] |
LDCM0022 | KB02 | 22RV1 | C27(3.58) | LDD2243 | [4] |
LDCM0023 | KB03 | 22RV1 | C27(7.70) | LDD2660 | [4] |
LDCM0024 | KB05 | HMCB | C27(5.04) | LDD3312 | [4] |
LDCM0021 | THZ1 | HCT 116 | C27(1.11); C119(1.02) | LDD2173 | [7] |
References