Details of the Target
General Information of Target
| Target ID | LDTP17235 | |||||
|---|---|---|---|---|---|---|
| Target Name | Probable gluconokinase (IDNK) | |||||
| Gene Name | IDNK | |||||
| Gene ID | 414328 | |||||
| Synonyms |
C9orf103; Probable gluconokinase; EC 2.7.1.12; Gluconate kinase |
|||||
| 3D Structure | ||||||
| Sequence |
MLWVQRKRRRKETSECPSDKDKSPESHKAKNESWIKSHFSRLSEEKLALDNNASASGNAT
QTESGSEEVSSTVHIETFTTRHGEVGSALHRESFTSRQKTSGPSVIQEIHQESGKAPSTD EATWAAVAACTKEIDTQGRHLAHSMLQRAIAYQHSGHLESKDINQEELRALEEVEMKLQK NFLTQRENTIAGANHTHTFYGHSHHSHHGHPSHQSHSLPNRRH |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Gluconokinase GntK/GntV family
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C83(1.12) | LDD3339 | [1] | |
|
IA-alkyne Probe Info |
![]() |
C105(1.26) | LDD2182 | [2] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2225 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0632 | CL-Sc | Hep-G2 | C63(0.41) | LDD2227 | [3] |
| LDCM0572 | Fragment10 | Ramos | C105(1.55) | LDD2189 | [2] |
| LDCM0574 | Fragment12 | Ramos | C105(1.14) | LDD2191 | [2] |
| LDCM0575 | Fragment13 | Ramos | C105(1.06) | LDD2192 | [2] |
| LDCM0576 | Fragment14 | Ramos | C105(0.30) | LDD2193 | [2] |
| LDCM0579 | Fragment20 | Ramos | C105(1.51) | LDD2194 | [2] |
| LDCM0580 | Fragment21 | Ramos | C105(0.96) | LDD2195 | [2] |
| LDCM0582 | Fragment23 | Ramos | C105(1.62) | LDD2196 | [2] |
| LDCM0578 | Fragment27 | Ramos | C105(1.79) | LDD2197 | [2] |
| LDCM0586 | Fragment28 | Ramos | C105(0.48) | LDD2198 | [2] |
| LDCM0588 | Fragment30 | Ramos | C105(0.61) | LDD2199 | [2] |
| LDCM0589 | Fragment31 | Ramos | C105(0.73) | LDD2200 | [2] |
| LDCM0590 | Fragment32 | Ramos | C105(1.00) | LDD2201 | [2] |
| LDCM0468 | Fragment33 | Ramos | C105(0.96) | LDD2202 | [2] |
| LDCM0596 | Fragment38 | Ramos | C105(0.84) | LDD2203 | [2] |
| LDCM0566 | Fragment4 | Ramos | C105(0.63) | LDD2184 | [2] |
| LDCM0614 | Fragment56 | Ramos | C105(1.08) | LDD2205 | [2] |
| LDCM0569 | Fragment7 | Ramos | C105(1.31) | LDD2186 | [2] |
| LDCM0022 | KB02 | Ramos | C105(1.26) | LDD2182 | [2] |
| LDCM0023 | KB03 | Ramos | C105(0.40) | LDD2183 | [2] |
| LDCM0024 | KB05 | NALM-6 | C83(1.12) | LDD3339 | [1] |
References



