Details of the Target | Chem(Pro)²

General Information of Target

Target ID	LDTP17178
Target Name	Putative malate dehydrogenase 1B (MDH1B)
Gene Name	MDH1B
Gene ID	130752
Synonyms	Putative malate dehydrogenase 1B; EC 1.1.1.-
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MAAPPKAPIRVRNLTIRAGALTGKENNMLQPETHIFTAPEEGSSQGALLLGQAPEPLSLP CTPVTLEQQLVSPSGDPHRAPALPSICSTLILQPCATLDPLLLQPQVPKVSDQALVSAHS EWQRKLEAAEALLTLRNSAQAPPDSISLHQPCNPPAPAGDKGFQPPSPSLRPRPASSISL PIGHLGCISLLS
Target Bioclass	Enzyme
Family	LDH/MDH superfamily, MDH type 2 family
Uniprot ID	Q5I0G3
Ensemble ID	ENST00000374412.8
HGNC ID	HGNC:17836

Target Site Mutations in Different Cell Lines

Cell line	Mutation details			Probe for labeling this protein in this cell
COLO792	SNV: p.P495S			.
HCT15	SNV: p.G369Ter; p.Ter519KextTer15			.
IGROV1	Deletion: p.N481IfsTer2			.
PF382	SNV: p.S196P			.

Probe(s) Labeling This Target

ABPP Probe

Click To Hide/Show 2 Probe Related to This Target

Probe name		Structure	Binding Site(Ratio)	Interaction ID	Ref
Acrolein Probe Info			N.A.	LDD0223	[1]
TPP-AC Probe Info			N.A.	LDD0427	[2]

Competitor(s) Related to This Target

Competitor ID	Name	Cell line	Binding Site(Ratio)	Interaction ID	Ref
LDCM0109	NEM	HeLa	N.A.	LDD0223	[1]

References

1	ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
2	Differently Tagged Probes for Protein Profiling of Mitochondria. Chembiochem. 2019 May 2;20(9):1155-1160. doi: 10.1002/cbic.201800735. Epub 2019 Mar 26.