Details of the Target
General Information of Target
| Target ID | LDTP17054 | |||||
|---|---|---|---|---|---|---|
| Target Name | Neuronatin (NNAT) | |||||
| Gene Name | NNAT | |||||
| Gene ID | 4826 | |||||
| Synonyms |
Neuronatin |
|||||
| 3D Structure | ||||||
| Sequence |
MLSQKPKKKHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTQEKRETGDEENSA
KFPVGRRDFDTLSCMLGRVYQSCWQV |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Neuronatin family
|
|||||
| Function |
May participate in the maintenance of segment identity in the hindbrain and pituitary development, and maturation or maintenance of the overall structure of the nervous system. May function as a regulatory subunit of ion channels.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
YN-1 Probe Info |
 |
N.A. | LDD0446 | [1] | |