Details of the Target
General Information of Target
| Target ID | LDTP16909 | |||||
|---|---|---|---|---|---|---|
| Target Name | RANBP2-like and GRIP domain-containing protein 1 (RGPD1) | |||||
| Gene Name | RGPD1 | |||||
| Gene ID | 400966 | |||||
| Synonyms |
RANBP2L6; RGP1; RANBP2-like and GRIP domain-containing protein 1; Ran-binding protein 2-like 6; RanBP2-like 6; RanBP2L6 |
|||||
| 3D Structure | ||||||
| Sequence |
MAFSGRARPCIIPENEEIPRAALNTVHEANGTEDERAVSKLQRRHSDVKVYKEFCDFYAK
FNMANALASATCERCKGGFAPAETIVNSNGELYHEQCFVCAQCFQQFPEGLFYEERT |
|||||
| Target Bioclass |
Other
|
|||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C82(3.22); C101(1.98); C2381(3.08); C206(2.69) | LDD3311 | [1] | |
|
AHL-Pu-1 Probe Info |
 |
C528(2.08); C211(2.15) | LDD0169 | [2] | |
|
IA-alkyne Probe Info |
 |
C340(0.00); C528(0.00); C1093(0.00); C1390(0.00) | LDD0166 | [3] | |
|
NAIA_5 Probe Info |
 |
N.A. | LDD2224 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0026 | 4SU-RNA+native RNA | HEK-293T | C528(2.08); C211(2.15) | LDD0169 | [2] |
| LDCM0022 | KB02 | 22RV1 | C349(2.12); C82(2.07); C101(1.20); C2381(1.92) | LDD2243 | [1] |
| LDCM0023 | KB03 | 22RV1 | C349(2.49); C82(4.12); C101(1.42); C2381(2.93) | LDD2660 | [1] |
| LDCM0024 | KB05 | G361 | C82(3.22); C101(1.98); C2381(3.08); C206(2.69) | LDD3311 | [1] |
References