Details of the Target
General Information of Target
| Target ID | LDTP16789 | |||||
|---|---|---|---|---|---|---|
| Target Name | TPR and ankyrin repeat-containing protein 1 (TRANK1) | |||||
| Gene Name | TRANK1 | |||||
| Gene ID | 9881 | |||||
| Synonyms |
KIAA0342; LBA1; TPR and ankyrin repeat-containing protein 1; Lupus brain antigen 1 homolog |
|||||
| 3D Structure | ||||||
| Sequence |
MSASTSSHRPIKGILKNKSSSGSSVATSGQQSGGTIQDVKRKKSQKWDESSILAAHRATY
RDYDLMKANEPGTSYMSVQDNGEDSVRDVEGEDSVRGVEGKEATDASDHSCEVDEQESSE AYMRKILLHKQEKKRQFEMRRRLHYNEELNIKLARQLMWKELQSEDNENEETPQGTNEEK TAAEESEEAPLTGGLQTQSCDP |
|||||
| Target Bioclass |
Other
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C646(3.81) | LDD3310 | [1] | |
|
IA-alkyne Probe Info |
 |
C338(0.00); C241(0.00); C542(0.00); C162(0.00) | LDD0161 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0575 | Fragment13 | Ramos | C41(1.17) | LDD2192 | [3] |
| LDCM0578 | Fragment27 | Ramos | C41(0.61) | LDD2197 | [3] |
| LDCM0596 | Fragment38 | Ramos | C41(0.20) | LDD2203 | [3] |
| LDCM0022 | KB02 | T cell | C1319(20.00); C882(6.58) | LDD1703 | [4] |
| LDCM0023 | KB03 | A3-KAW | C646(4.56) | LDD2674 | [1] |
| LDCM0024 | KB05 | COLO792 | C646(3.81) | LDD3310 | [1] |
References