Details of the Target
General Information of Target
| Target ID | LDTP16786 | |||||
|---|---|---|---|---|---|---|
| Target Name | RANBP2-like and GRIP domain-containing protein 8 (RGPD8) | |||||
| Gene Name | RGPD8 | |||||
| Gene ID | 727851 | |||||
| Synonyms |
RANBP2ALPHA; RANBP2L1; RANBP2L3; RANBP2-like and GRIP domain-containing protein 8; Ran-binding protein 2-like 3; RanBP2-like 3; RanBP2L3 |
|||||
| 3D Structure | ||||||
| Sequence |
MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES
|
|||||
| Target Bioclass |
Other
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C815(1.82) | LDD3403 | [1] | |
|
AHL-Pu-1 Probe Info |
 |
C50(2.31) | LDD0168 | [2] | |
|
IA-alkyne Probe Info |
 |
C449(0.00); C528(0.00); C81(0.00); C134(0.00) | LDD0161 | [3] | |
|
IPM Probe Info |
 |
C815(0.00); C707(0.00) | LDD2156 | [4] | |
|
Phosphinate-6 Probe Info |
 |
C188(0.00); C1601(0.00); C105(0.00); C1488(0.00) | LDD0018 | [5] | |
|
NAIA_5 Probe Info |
 |
N.A. | LDD2223 | [6] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0025 | 4SU-RNA | HEK-293T | C50(2.31) | LDD0168 | [2] |
| LDCM0026 | 4SU-RNA+native RNA | HEK-293T | C537(2.08); C220(2.15); C50(2.22) | LDD0169 | [2] |
| LDCM0022 | KB02 | 697 | C815(1.42) | LDD2245 | [1] |
| LDCM0023 | KB03 | 697 | C815(2.33) | LDD2662 | [1] |
| LDCM0024 | KB05 | Reh | C815(1.82) | LDD3403 | [1] |
References