Details of the Target
General Information of Target
| Target ID | LDTP16697 | |||||
|---|---|---|---|---|---|---|
| Target Name | Putative zinc finger protein 727 (ZNF727) | |||||
| Gene Name | ZNF727 | |||||
| Gene ID | 442319 | |||||
| Synonyms |
ZNF727P; Putative zinc finger protein 727; Zinc finger protein 727 pseudogene |
|||||
| 3D Structure | ||||||
| Sequence |
MSFLTVPYKLPVSLSVGSCVIIKGTLIDSSINEPQLQVDFYTEMNEDSEIAFHLRVHLGR
RVVMNSREFGIWMLEENLHYVPFEDGKPFDLRIYVCHNEYEVKVNGEYIYAFVHRIPPSY VKMIQVWRDVSLDSVLVNNGRR |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Krueppel C2H2-type zinc-finger protein family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function | May be involved in transcriptional regulation. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
8.69 | LDD2182 | [1] | |
|
HHS-465 Probe Info |
![]() |
K282(0.00); K285(0.00); Y284(0.00) | LDD2240 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | 1.66 | LDD2187 | [1] |
| LDCM0572 | Fragment10 | Ramos | 2.88 | LDD2189 | [1] |
| LDCM0573 | Fragment11 | Ramos | 5.20 | LDD2190 | [1] |
| LDCM0574 | Fragment12 | Ramos | 2.46 | LDD2191 | [1] |
| LDCM0575 | Fragment13 | Ramos | 0.90 | LDD2192 | [1] |
| LDCM0576 | Fragment14 | Ramos | 2.74 | LDD2193 | [1] |
| LDCM0579 | Fragment20 | Ramos | 4.20 | LDD2194 | [1] |
| LDCM0580 | Fragment21 | Ramos | 1.02 | LDD2195 | [1] |
| LDCM0582 | Fragment23 | Ramos | 0.76 | LDD2196 | [1] |
| LDCM0578 | Fragment27 | Ramos | 0.67 | LDD2197 | [1] |
| LDCM0586 | Fragment28 | Ramos | 1.09 | LDD2198 | [1] |
| LDCM0588 | Fragment30 | Ramos | 1.06 | LDD2199 | [1] |
| LDCM0589 | Fragment31 | Ramos | 0.95 | LDD2200 | [1] |
| LDCM0590 | Fragment32 | Ramos | 3.36 | LDD2201 | [1] |
| LDCM0468 | Fragment33 | Ramos | 1.24 | LDD2202 | [1] |
| LDCM0596 | Fragment38 | Ramos | 1.14 | LDD2203 | [1] |
| LDCM0566 | Fragment4 | Ramos | 2.76 | LDD2184 | [1] |
| LDCM0610 | Fragment52 | Ramos | 1.02 | LDD2204 | [1] |
| LDCM0614 | Fragment56 | Ramos | 1.26 | LDD2205 | [1] |
| LDCM0569 | Fragment7 | Ramos | 5.43 | LDD2186 | [1] |
| LDCM0571 | Fragment9 | Ramos | 4.58 | LDD2188 | [1] |
| LDCM0022 | KB02 | Ramos | 8.69 | LDD2182 | [1] |
| LDCM0023 | KB03 | Ramos | 3.55 | LDD2183 | [1] |
| LDCM0024 | KB05 | Ramos | 9.92 | LDD2185 | [1] |
References


