Details of the Target
General Information of Target
Target ID | LDTP16655 | |||||
---|---|---|---|---|---|---|
Target Name | RanBP2-like and GRIP domain-containing protein 3 (RGPD3) | |||||
Gene Name | RGPD3 | |||||
Gene ID | 653489 | |||||
Synonyms |
RGP3; RanBP2-like and GRIP domain-containing protein 3 |
|||||
3D Structure | ||||||
Sequence |
MSTFPVLAEDIPLRERHVKGRVDPHFRAPKMEMFQRLLLLLLLSMGGTWASKEPLRPRCR
PINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLP GCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPS PSRLPGP |
|||||
Target Bioclass |
Other
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
m-APA Probe Info |
![]() |
12.54 | LDD0402 | [1] | |
IPM Probe Info |
![]() |
C141(0.00); C349(0.00); C1109(0.00); C1167(0.00) | LDD0241 | [2] | |
Probe 1 Probe Info |
![]() |
Y83(16.53); Y786(30.03); Y1008(6.99); Y1028(53.59) | LDD3495 | [3] | |
DBIA Probe Info |
![]() |
C84(2.44) | LDD3323 | [4] | |
AHL-Pu-1 Probe Info |
![]() |
C537(2.08); C220(2.15) | LDD0169 | [5] | |
HHS-475 Probe Info |
![]() |
Y1008(5.85) | LDD0264 | [6] | |
NAIA_5 Probe Info |
![]() |
C320(0.00); C481(0.00); C537(0.00) | LDD2223 | [7] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0026 | 4SU-RNA+native RNA | HEK-293T | C537(2.08); C220(2.15) | LDD0169 | [5] |
LDCM0116 | HHS-0101 | DM93 | Y1008(5.85) | LDD0264 | [6] |
LDCM0117 | HHS-0201 | DM93 | Y1008(3.57) | LDD0265 | [6] |
LDCM0119 | HHS-0401 | DM93 | Y1008(3.89) | LDD0267 | [6] |
LDCM0120 | HHS-0701 | DM93 | Y1008(0.92) | LDD0268 | [6] |
LDCM0022 | KB02 | 22RV1 | C525(4.09) | LDD2243 | [4] |
LDCM0023 | KB03 | 22RV1 | C525(5.12) | LDD2660 | [4] |
LDCM0024 | KB05 | SKMEL24 | C84(2.44) | LDD3323 | [4] |
References