Details of the Target
General Information of Target
| Target ID | LDTP16461 | |||||
|---|---|---|---|---|---|---|
| Target Name | Peptidyl-prolyl cis-trans isomerase A-like 4C (PPIAL4C) | |||||
| Gene Name | PPIAL4C | |||||
| Gene ID | 653598 | |||||
| Synonyms |
Peptidyl-prolyl cis-trans isomerase A-like 4C; PPIase A-like 4C; EC 5.2.1.8 |
|||||
| 3D Structure | ||||||
| Sequence |
MNSSLDFLILILMFGGTSSNSVKQTGQITVSEGASVTMNCTYTSTGYPTLFWYVEYPSKP
LQLLQRETMENSKNFGGGNIKDKNSPIVKYSVQVSDSAVYYCLLG |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Cyclophilin-type PPIase family, PPIase A subfamily
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
AZ-9 Probe Info |
![]() |
E120(1.12) | LDD2208 | [1] | |
|
AHL-Pu-1 Probe Info |
![]() |
C52(3.10) | LDD0168 | [2] | |
|
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
N.A. | LDD0038 | [3] | |
|
1c-yne Probe Info |
![]() |
N.A. | LDD0228 | [4] | |
|
Acrolein Probe Info |
![]() |
C62(0.00); C52(0.00) | LDD0217 | [5] | |
|
Cinnamaldehyde Probe Info |
![]() |
C62(0.00); C52(0.00) | LDD0220 | [5] | |
|
Crotonaldehyde Probe Info |
![]() |
C62(0.00); C52(0.00); H54(0.00) | LDD0219 | [5] | |
|
Methacrolein Probe Info |
![]() |
C62(0.00); C52(0.00) | LDD0218 | [5] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [6] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0025 | 4SU-RNA | HEK-293T | C52(3.10) | LDD0168 | [2] |
| LDCM0026 | 4SU-RNA+native RNA | HEK-293T | C52(3.02) | LDD0169 | [2] |
| LDCM0108 | Chloroacetamide | HeLa | C62(0.00); C52(0.00) | LDD0222 | [5] |
| LDCM0107 | IAA | HeLa | C62(0.00); C52(0.00); H54(0.00) | LDD0221 | [5] |
| LDCM0109 | NEM | HeLa | C62(0.00); C52(0.00); H54(0.00) | LDD0223 | [5] |
References









