Details of the Target
General Information of Target
Target ID | LDTP15769 | |||||
---|---|---|---|---|---|---|
Target Name | Sorting nexin-22 (SNX22) | |||||
Gene Name | SNX22 | |||||
Gene ID | 79856 | |||||
Synonyms |
Sorting nexin-22 |
|||||
3D Structure | ||||||
Sequence |
MPPRELSEAEPPPLRAPTPPPRRRSAPPELGIKCVLVGDGAVGKSSLIVSYTCNGYPARY
RPTALDTFSVQVLVDGAPVRIELWDTAGQEDFDRLRSLCYPDTDVFLACFSVVQPSSFQN ITEKWLPEIRTHNPQAPVLLVGTQADLRDDVNVLIQLDQGGREGPVPQPQAQGLAEKIRA CCYLECSALTQKNLKEVFDSAILSAIEHKARLEKKLNAKGVRTLSRCRWKKFFCFV |
|||||
Target Bioclass |
Transporter and channel
|
|||||
Family |
Sorting nexin family
|
|||||
Subcellular location |
Cytoplasmic vesicle membrane
|
|||||
Function | May be involved in several stages of intracellular trafficking. Interacts with membranes containing phosphatidylinositol 3-phosphate (PtdIns(3P)). | |||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C33(2.67) | LDD3339 | [1] | |
IA-alkyne Probe Info |
![]() |
C33(3.49); C184(1.65) | LDD2182 | [2] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0625 | F8 | Ramos | C33(1.05); C184(1.34) | LDD2187 | [2] |
LDCM0572 | Fragment10 | Ramos | C33(1.34) | LDD2189 | [2] |
LDCM0573 | Fragment11 | Ramos | C184(2.82) | LDD2190 | [2] |
LDCM0574 | Fragment12 | Ramos | C33(1.20) | LDD2191 | [2] |
LDCM0575 | Fragment13 | Ramos | C33(0.76) | LDD2192 | [2] |
LDCM0576 | Fragment14 | Ramos | C33(1.16); C184(0.82) | LDD2193 | [2] |
LDCM0579 | Fragment20 | Ramos | C33(1.12) | LDD2194 | [2] |
LDCM0580 | Fragment21 | Ramos | C33(0.90) | LDD2195 | [2] |
LDCM0582 | Fragment23 | Ramos | C33(1.17) | LDD2196 | [2] |
LDCM0578 | Fragment27 | Ramos | C33(0.76) | LDD2197 | [2] |
LDCM0586 | Fragment28 | Ramos | C33(0.73); C184(0.78) | LDD2198 | [2] |
LDCM0588 | Fragment30 | Ramos | C33(1.18) | LDD2199 | [2] |
LDCM0589 | Fragment31 | Ramos | C33(0.82) | LDD2200 | [2] |
LDCM0590 | Fragment32 | Ramos | C33(1.07) | LDD2201 | [2] |
LDCM0468 | Fragment33 | Ramos | C33(0.88) | LDD2202 | [2] |
LDCM0596 | Fragment38 | Ramos | C33(0.79) | LDD2203 | [2] |
LDCM0566 | Fragment4 | Ramos | C33(1.95); C184(1.06) | LDD2184 | [2] |
LDCM0610 | Fragment52 | Ramos | C33(1.40) | LDD2204 | [2] |
LDCM0569 | Fragment7 | Ramos | C33(1.63); C184(1.16) | LDD2186 | [2] |
LDCM0571 | Fragment9 | Ramos | C33(1.21) | LDD2188 | [2] |
LDCM0022 | KB02 | Ramos | C33(3.49); C184(1.65) | LDD2182 | [2] |
LDCM0023 | KB03 | Ramos | C33(1.48); C184(1.00) | LDD2183 | [2] |
LDCM0024 | KB05 | NALM-6 | C33(2.67) | LDD3339 | [1] |
References