Details of the Target
General Information of Target
| Target ID | LDTP15735 | |||||
|---|---|---|---|---|---|---|
| Target Name | Protein FMC1 homolog (FMC1) | |||||
| Gene Name | FMC1 | |||||
| Gene ID | 100996928 | |||||
| Synonyms |
C7orf55; Protein FMC1 homolog; ATP synthase assembly factor FMC1, mitochondrial; Formation of mitochondrial complex V assembly factor 1 homolog |
|||||
| 3D Structure | ||||||
| Sequence |
MPKFKQRRRKLKAKAERLFKKKEASHFQSKLITPPPPPPSPERVGISSIDISQSRSWLTS
SWNFNFPNIRDAIKLWTNRVWSIYSWCQNCITQSLEVLKDTIFPSRICHRELYSVKQQFC ILESKLCKLQEALKTISESSSCPSCGQTCHMSGKLTNVPACVLITPGDSKAVLPPTLPQP ASHFPPPPPPPPLPPPPPPLAPVLLRKPSLAKALQAGPLKKDGPMQITVKDLLTVKLKKT QSLDEKRKLIPSPKARNPLVTVSDLQHVTLKPNSKVLSTRVTNVLITPGKSQMDLRKLLR KVDVERSPGGTPLTNKENMETGTGLTPVMTQALRRKFQLAHPRSPTPTLPLSTSSFDEQN |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
FMC1 family
|
|||||
| Subcellular location |
Mitochondrion
|
|||||
| Function | Plays a role in the assembly/stability of the mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V). | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
m-APA Probe Info |
![]() |
15.00 | LDD0402 | [1] | |
|
STPyne Probe Info |
![]() |
K101(8.75); K40(1.27) | LDD0277 | [2] | |
|
DBIA Probe Info |
![]() |
C68(1.70) | LDD3314 | [3] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0036 | [4] | |
|
Lodoacetamide azide Probe Info |
![]() |
N.A. | LDD0037 | [4] | |
|
TFBX Probe Info |
![]() |
N.A. | LDD0027 | [5] | |
|
IPM Probe Info |
![]() |
N.A. | LDD2156 | [6] | |
|
Phosphinate-6 Probe Info |
![]() |
C68(0.00); C53(0.00) | LDD0018 | [7] | |
|
AOyne Probe Info |
![]() |
15.00 | LDD0443 | [8] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [9] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0156 | Aniline | NCI-H1299 | 15.00 | LDD0403 | [1] |
| LDCM0625 | F8 | Ramos | C53(1.75) | LDD2187 | [10] |
| LDCM0573 | Fragment11 | Ramos | C53(2.93) | LDD2190 | [10] |
| LDCM0574 | Fragment12 | Ramos | C53(0.61) | LDD2191 | [10] |
| LDCM0575 | Fragment13 | Ramos | C53(0.77) | LDD2192 | [10] |
| LDCM0576 | Fragment14 | Ramos | C53(0.37) | LDD2193 | [10] |
| LDCM0579 | Fragment20 | Ramos | C53(0.35) | LDD2194 | [10] |
| LDCM0580 | Fragment21 | Ramos | C53(0.63) | LDD2195 | [10] |
| LDCM0582 | Fragment23 | Ramos | C53(0.54) | LDD2196 | [10] |
| LDCM0578 | Fragment27 | Ramos | C53(0.58) | LDD2197 | [10] |
| LDCM0586 | Fragment28 | Ramos | C53(0.80) | LDD2198 | [10] |
| LDCM0588 | Fragment30 | Ramos | C53(0.94) | LDD2199 | [10] |
| LDCM0589 | Fragment31 | Ramos | C53(0.54) | LDD2200 | [10] |
| LDCM0590 | Fragment32 | Ramos | C53(3.14) | LDD2201 | [10] |
| LDCM0468 | Fragment33 | Ramos | C53(0.99) | LDD2202 | [10] |
| LDCM0596 | Fragment38 | Ramos | C53(0.57) | LDD2203 | [10] |
| LDCM0566 | Fragment4 | Ramos | C53(0.62) | LDD2184 | [10] |
| LDCM0610 | Fragment52 | Ramos | C53(1.02) | LDD2204 | [10] |
| LDCM0614 | Fragment56 | Ramos | C53(1.50) | LDD2205 | [10] |
| LDCM0569 | Fragment7 | Ramos | C53(0.54) | LDD2186 | [10] |
| LDCM0571 | Fragment9 | Ramos | C53(1.04) | LDD2188 | [10] |
| LDCM0022 | KB02 | 42-MG-BA | C68(1.24) | LDD2244 | [3] |
| LDCM0023 | KB03 | Ramos | C53(0.66) | LDD2183 | [10] |
| LDCM0024 | KB05 | IGR37 | C68(1.70) | LDD3314 | [3] |
| LDCM0627 | NUDT7-COV-1 | HEK-293T | C68(1.51) | LDD2206 | [11] |
References










