Details of the Target
General Information of Target
| Target ID | LDTP15678 | |||||
|---|---|---|---|---|---|---|
| Target Name | ADP-ribosylation factor-like protein 11 (ARL11) | |||||
| Gene Name | ARL11 | |||||
| Gene ID | 115761 | |||||
| Synonyms |
ARLTS1; ADP-ribosylation factor-like protein 11; ADP-ribosylation factor-like tumor suppressor protein 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKA
KTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Small GTPase superfamily, Arf family
|
|||||
| Function | May play a role in apoptosis. May act as a tumor suppressor. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
HHS-475 Probe Info |
![]() |
Y30(0.83) | LDD0264 | [1] | |
|
IA-alkyne Probe Info |
![]() |
0.78 | LDD2187 | [2] | |
|
HHS-465 Probe Info |
![]() |
Y30(7.78) | LDD2237 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | 0.78 | LDD2187 | [2] |
| LDCM0575 | Fragment13 | Ramos | 1.06 | LDD2192 | [2] |
| LDCM0576 | Fragment14 | Ramos | 1.46 | LDD2193 | [2] |
| LDCM0580 | Fragment21 | Ramos | 0.83 | LDD2195 | [2] |
| LDCM0582 | Fragment23 | Ramos | 2.07 | LDD2196 | [2] |
| LDCM0578 | Fragment27 | Ramos | 0.90 | LDD2197 | [2] |
| LDCM0586 | Fragment28 | Ramos | 1.00 | LDD2198 | [2] |
| LDCM0588 | Fragment30 | Ramos | 1.61 | LDD2199 | [2] |
| LDCM0468 | Fragment33 | Ramos | 1.72 | LDD2202 | [2] |
| LDCM0596 | Fragment38 | Ramos | 0.55 | LDD2203 | [2] |
| LDCM0614 | Fragment56 | Ramos | 1.30 | LDD2205 | [2] |
| LDCM0116 | HHS-0101 | DM93 | Y30(0.83) | LDD0264 | [1] |
| LDCM0117 | HHS-0201 | DM93 | Y30(0.84) | LDD0265 | [1] |
| LDCM0118 | HHS-0301 | DM93 | Y30(0.77) | LDD0266 | [1] |
| LDCM0119 | HHS-0401 | DM93 | Y30(0.88) | LDD0267 | [1] |
| LDCM0120 | HHS-0701 | DM93 | Y30(1.19) | LDD0268 | [1] |
References



