Details of the Target
General Information of Target
| Target ID | LDTP15641 | |||||
|---|---|---|---|---|---|---|
| Target Name | Insulin-like growth factor-binding protein-like 1 (IGFBPL1) |
|
||||
| Gene Name | IGFBPL1 | |||||
| Gene ID | 347252 | |||||
| Synonyms |
IGFBPRP4; Insulin-like growth factor-binding protein-like 1; IGFBP-related protein 10; Insulin-like growth factor-binding-related protein 4; IGFBP-rP4 |
|||||
| 3D Structure | ||||||
| Sequence |
MGSSSFLVLMVSLVLVTLVAVEGVKEGIEKAGVCPADNVRCFKSDPPQCHTDQDCLGERK
CCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKCPGSSSTRCPQK |
|||||
| Target Bioclass |
Immunoglobulin
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
IGF-binding proteins prolong the half-life of IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs in cell culture. They alter the interaction of IGFs with their cell surface receptors. May be a putative tumor suppressor protein.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
FBPP2 Probe Info |
 |
18.19 | LDD0318 | [1] | |
|
DBIA Probe Info |
 |
C115(2.54) | LDD3342 | [2] | |
Competitor(s) Related to This Target
References