Details of the Target

General Information of Target

Target ID LDTP15428
Target Name Tetratricopeptide repeat protein 9C (TTC9C)
Gene Name TTC9C
Gene ID 283237
Synonyms
Tetratricopeptide repeat protein 9C; TPR repeat protein 9C
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGS
GRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVL
LSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS
Target Bioclass
Other
Family
TTC9 family
Uniprot ID
Q8N5M4
Ensemble ID
ENST00000316461.9
HGNC ID
HGNC:28432

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HT SNV: p.P57L .
MEWO SNV: p.A133P .
RKO SNV: p.Y158C .
SKMEL30 SNV: p.Y124Ter .
SW756 SNV: p.R33Ter .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 6 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C-Sul
 Probe Info  		2.89  LDD0066  [1]
STPyne
 Probe Info  		K109(8.82); K12(6.25); K140(5.88); K99(9.05)  LDD0277  [2]
Probe 1
 Probe Info  		Y11(27.05); Y130(18.91)  LDD3495  [3]
Acrolein
 Probe Info  		N.A.  LDD0221  [4]
m-APA
 Probe Info  		H120(0.00); H129(0.00)  LDD2231  [5]
AOyne
 Probe Info  		14.60  LDD0443  [6]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0108  Chloroacetamide HeLa N.A.  LDD0222  [4]
 LDCM0107  IAA HeLa N.A.  LDD0221  [4]
 LDCM0109  NEM HeLa N.A.  LDD0223  [4]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
S-phase kinase-associated protein 1 (SKP1) SKP1 family P63208
Tripartite motif-containing protein 54 (TRIM54) . Q9BYV2
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Leucine zipper putative tumor suppressor 1 (LZTS1) LZTS family Q9Y250
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein MOX-2 (MEOX2) . P50222
Transcriptional adapter 2-alpha (TADA2A) . O75478
Other
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Golgin subfamily A member 2 (GOLGA2) GOLGA2 family Q08379
Keratin, type I cuticular Ha1 (KRT31) Intermediate filament family Q15323
Keratin, type I cuticular Ha4 (KRT34) Intermediate filament family O76011
Keratin, type I cytoskeletal 40 (KRT40) Intermediate filament family Q6A162
Harmonin-binding protein USHBP1 (USHBP1) MCC family Q8N6Y0
Paraneoplastic antigen Ma1 (PNMA1) PNMA family Q8ND90
Toll-interacting protein (TOLLIP) Tollip family Q9H0E2
Heat shock factor 2-binding protein (HSF2BP) . O75031
Nicolin-1 (NICN1) . Q9BSH3
Pleckstrin homology domain-containing family F member 2 (PLEKHF2) . Q9H8W4

References

1 Low-Toxicity Sulfonium-Based Probes for Cysteine-Specific Profiling in Live Cells. Anal Chem. 2022 Mar 15;94(10):4366-4372. doi: 10.1021/acs.analchem.1c05129. Epub 2022 Mar 4.
2 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
3 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
4 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
5 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
6 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.