Details of the Target
General Information of Target
| Target ID | LDTP15421 | |||||
|---|---|---|---|---|---|---|
| Target Name | Intraflagellar transport protein 70B (IFT70B) | |||||
| Gene Name | IFT70B | |||||
| Gene ID | 150737 | |||||
| Synonyms |
TTC30B; Intraflagellar transport protein 70B; Tetratricopeptide repeat protein 30B; TPR repeat protein 30B |
|||||
| 3D Structure | ||||||
| Sequence |
MFRIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLDSI
|
|||||
| Target Bioclass |
Other
|
|||||
| Family |
TTC30/dfy-1/fleer family
|
|||||
| Subcellular location |
Cell projection, cilium
|
|||||
| Function |
Required for polyglutamylation of axonemal tubulin. Plays a role in anterograde intraflagellar transport (IFT), the process by which cilia precursors are transported from the base of the cilium to the site of their incorporation at the tip.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C589(12.83) | LDD0205 | [1] | |
|
IA-alkyne Probe Info |
 |
C54(0.00); C174(0.00) | LDD0165 | [2] | |
|
AOyne Probe Info |
 |
15.00 | LDD0443 | [3] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References