Details of the Target
General Information of Target
Target ID | LDTP15319 | |||||
---|---|---|---|---|---|---|
Target Name | Protein Niban 3 (NIBAN3) | |||||
Gene Name | NIBAN3 | |||||
Gene ID | 199786 | |||||
Synonyms |
BCNP1; FAM129C; Protein Niban 3; B-cell novel protein 1; Niban-like protein 2; Protein FAM129C |
|||||
3D Structure | ||||||
Sequence |
MKILVAFLVVLTIFGIQSHGYEVFNIISPSNNGGNVQETVTIDNEKNTAIINIHAGSCSS
TTIFDYKHGYIASRVLSRRACFILKMDHQNIPPLNNLQWYIYEKQALDNMFSSKYTWVKY NPLESLIKDVDWFLLGSPIEKLCKHIPLYKGEVVENTHNVGAGGCAKAGLLGILGISICA DIHV |
|||||
Target Bioclass |
Other
|
|||||
Family |
Niban family
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C579(2.14); C93(1.39) | LDD3339 | [1] | |
IA-alkyne Probe Info |
![]() |
C62(0.35) | LDD2182 | [2] | |
IPM Probe Info |
![]() |
C579(1.01) | LDD1702 | [3] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0213 | Electrophilic fragment 2 | MDA-MB-231 | C579(1.01) | LDD1702 | [3] |
LDCM0625 | F8 | Ramos | C62(0.35) | LDD2187 | [2] |
LDCM0572 | Fragment10 | Ramos | C62(0.57) | LDD2189 | [2] |
LDCM0573 | Fragment11 | Ramos | C62(0.17) | LDD2190 | [2] |
LDCM0574 | Fragment12 | Ramos | C62(0.89) | LDD2191 | [2] |
LDCM0575 | Fragment13 | Ramos | C62(0.78) | LDD2192 | [2] |
LDCM0576 | Fragment14 | Ramos | C62(0.55) | LDD2193 | [2] |
LDCM0579 | Fragment20 | Ramos | C62(0.73) | LDD2194 | [2] |
LDCM0580 | Fragment21 | Ramos | C62(0.70) | LDD2195 | [2] |
LDCM0582 | Fragment23 | Ramos | C62(0.56) | LDD2196 | [2] |
LDCM0578 | Fragment27 | Ramos | C62(0.68) | LDD2197 | [2] |
LDCM0586 | Fragment28 | Ramos | C62(0.87) | LDD2198 | [2] |
LDCM0588 | Fragment30 | Ramos | C62(0.81) | LDD2199 | [2] |
LDCM0589 | Fragment31 | Ramos | C62(1.00) | LDD2200 | [2] |
LDCM0590 | Fragment32 | Ramos | C62(0.76) | LDD2201 | [2] |
LDCM0468 | Fragment33 | Ramos | C62(0.85) | LDD2202 | [2] |
LDCM0596 | Fragment38 | Ramos | C62(0.69) | LDD2203 | [2] |
LDCM0566 | Fragment4 | Ramos | C62(0.69) | LDD2184 | [2] |
LDCM0610 | Fragment52 | Ramos | C62(0.81) | LDD2204 | [2] |
LDCM0614 | Fragment56 | Ramos | C62(1.06) | LDD2205 | [2] |
LDCM0569 | Fragment7 | Ramos | C62(0.45) | LDD2186 | [2] |
LDCM0571 | Fragment9 | Ramos | C62(0.72) | LDD2188 | [2] |
LDCM0022 | KB02 | Ramos | C62(0.35) | LDD2182 | [2] |
LDCM0023 | KB03 | Ramos | C62(0.52) | LDD2183 | [2] |
LDCM0024 | KB05 | NALM-6 | C579(2.14); C93(1.39) | LDD3339 | [1] |
References