Details of the Target
General Information of Target
| Target ID | LDTP15189 | |||||
|---|---|---|---|---|---|---|
| Target Name | WD repeat- and FYVE domain-containing protein 4 (WDFY4) | |||||
| Gene Name | WDFY4 | |||||
| Gene ID | 57705 | |||||
| Synonyms |
C10orf64; KIAA1607; WD repeat- and FYVE domain-containing protein 4 |
|||||
| 3D Structure | ||||||
| Sequence |
MLENYGAVASLAAFPFPKPALISQLERGETPWCSVPRGALDGEAPRGISSGYPFLKPAGI
SHPEQVEEPLNLKLQGEGPSLICPEGVLKRKKEDFILKEEIIEEAQDLMVLSSGPQWCGS QELWFGKTCEEKSRLGRWPGYLNGGRMESSTNDIIEVIVKDEMISVEESSGNTDVNNLLG IHHKILNEQIFYICEECGKCFDQNEDFDQHQKTHNGEKVYGCKECGKAFSFRSHCIAHQR IHSGVKPYECQECAKAFVWKSNLIRHQRIHTGEKPFECKECGKGFSQNTSLTQHQRIHTG EKPYTCKECGKSFTRNPALLRHQRMHTGEKPYECKDCGKGFMWNSDLSQHQRVHTGDKPH ECTDCGKSFFCKAHLIRHQRIHTGERPYKCNDCGKAFSQNSVLIKHQRRHARDKPYNCQI SHLLEH |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Early endosome
|
|||||
| Function |
Plays a critical role in the regulation of cDC1-mediated cross-presentation of viral and tumor antigens in dendritic cells. Mechanistically, acts near the plasma membrane and interacts with endosomal membranes to promote endosomal-to-cytosol antigen trafficking. Also plays a role in B-cell survival through regulation of autophagy.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C2510(4.28) | LDD3333 | [1] | |
|
IA-alkyne Probe Info |
![]() |
C1336(0.63); C1665(1.02) | LDD2182 | [2] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0227 | [3] | |
|
NAIA_4 Probe Info |
![]() |
C1182(0.00); C1177(0.00) | LDD2226 | [4] | |
|
1d-yne Probe Info |
![]() |
N.A. | LDD0356 | [5] | |
|
Crotonaldehyde Probe Info |
![]() |
N.A. | LDD0219 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C1336(1.14); C1665(0.85); C1696(0.79); C1963(1.11) | LDD2187 | [2] |
| LDCM0572 | Fragment10 | Ramos | C1336(1.04); C1696(1.41); C1260(1.22) | LDD2189 | [2] |
| LDCM0573 | Fragment11 | Ramos | C1336(0.16); C1696(0.50); C1260(2.46) | LDD2190 | [2] |
| LDCM0574 | Fragment12 | Ramos | C1336(1.54); C1696(2.23); C1963(17.81) | LDD2191 | [2] |
| LDCM0575 | Fragment13 | Ramos | C1336(1.04); C1696(1.15); C1963(1.47) | LDD2192 | [2] |
| LDCM0576 | Fragment14 | Ramos | C1336(0.73); C1665(0.70); C1696(1.50) | LDD2193 | [2] |
| LDCM0579 | Fragment20 | Ramos | C1336(1.28); C1696(2.33) | LDD2194 | [2] |
| LDCM0580 | Fragment21 | Ramos | C1336(0.96); C1696(1.14); C1963(1.68); C1260(1.99) | LDD2195 | [2] |
| LDCM0582 | Fragment23 | Ramos | C1336(0.79); C1696(0.65); C545(0.75); C1963(0.95) | LDD2196 | [2] |
| LDCM0578 | Fragment27 | Ramos | C1336(1.34); C1696(0.78); C545(0.65); C1963(0.89) | LDD2197 | [2] |
| LDCM0586 | Fragment28 | Ramos | C1336(0.62); C1665(1.54); C1696(1.40); C545(0.84) | LDD2198 | [2] |
| LDCM0588 | Fragment30 | Ramos | C1336(1.66); C1696(1.24); C1963(1.66); C1260(2.18) | LDD2199 | [2] |
| LDCM0589 | Fragment31 | Ramos | C1336(0.95); C1696(0.84); C545(1.81); C1963(0.91) | LDD2200 | [2] |
| LDCM0590 | Fragment32 | Ramos | C1336(0.92); C1696(2.05); C1260(1.29) | LDD2201 | [2] |
| LDCM0468 | Fragment33 | Ramos | C1336(1.06); C1696(1.23); C545(2.11); C1963(1.52) | LDD2202 | [2] |
| LDCM0596 | Fragment38 | Ramos | C1336(1.22); C1696(1.08); C1260(0.73) | LDD2203 | [2] |
| LDCM0566 | Fragment4 | Ramos | C1336(0.89); C1665(1.55) | LDD2184 | [2] |
| LDCM0610 | Fragment52 | Ramos | C1336(1.67); C1696(1.98); C1260(0.86) | LDD2204 | [2] |
| LDCM0614 | Fragment56 | Ramos | C1336(2.98); C1696(1.09); C1963(0.96); C1260(1.30) | LDD2205 | [2] |
| LDCM0569 | Fragment7 | Ramos | C1336(0.84); C1665(1.82); C1696(1.40) | LDD2186 | [2] |
| LDCM0571 | Fragment9 | Ramos | C1336(0.92) | LDD2188 | [2] |
| LDCM0022 | KB02 | Ramos | C1336(0.63); C1665(1.02) | LDD2182 | [2] |
| LDCM0023 | KB03 | Ramos | C1336(0.72); C1665(1.24); C1963(1.66) | LDD2183 | [2] |
| LDCM0024 | KB05 | MOLM-13 | C2510(4.28) | LDD3333 | [1] |
| LDCM0109 | NEM | HeLa | N.A. | LDD0227 | [3] |
The Interaction Atlas With This Target
References






