Details of the Target

General Information of Target

Target ID LDTP15107
Target Name General transcription factor IIH subunit 2-like protein (GTF2H2C; GTF2H2C_2)
Gene Name GTF2H2C; GTF2H2C_2
Gene ID 728340
Synonyms
; GTF2H2D; General transcription factor IIH subunit 2-like protein; General transcription factor IIH polypeptide 2-like protein
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGAIDPDVFKILV
DLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRNKGSAALGGALA
LAERSSREGSSQRMPRQPSATRLPKGGGPGKSPTRGST
Target Bioclass
Other
Family
GTF2H2 family
Subcellular location
Nucleus
Function Component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II.
Uniprot ID
Q6P1K8
Ensemble ID
ENST00000380729.8
HGNC ID
HGNC:31394

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 9 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		12.92  LDD0402  [1]
IPM
 Probe Info  		C308(0.00); C299(0.00)  LDD0241  [2]
DBIA
 Probe Info  		C308(0.98)  LDD3312  [3]
BTD
 Probe Info  		C208(0.78)  LDD2125  [4]
4-Iodoacetamidophenylacetylene
 Probe Info  		C139(0.00); C308(0.00); C247(0.00)  LDD0038  [5]
IA-alkyne
 Probe Info  		N.A.  LDD0036  [5]
Lodoacetamide azide
 Probe Info  		C139(0.00); C308(0.00); C208(0.00); C299(0.00)  LDD0037  [5]
NAIA_5
 Probe Info  		N.A.  LDD2224  [6]
AOyne
 Probe Info  		14.10  LDD0443  [7]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0539  3-(4-Isopropylpiperazin-1-yl)-3-oxopropanenitrile MDA-MB-231 C308(0.58)  LDD2132  [4]
 LDCM0226  AC11 HEK-293T C2(1.01)  LDD1509  [8]
 LDCM0278  AC19 HEK-293T C2(0.84)  LDD1517  [8]
 LDCM0287  AC27 HEK-293T C2(0.93)  LDD1526  [8]
 LDCM0290  AC3 HEK-293T C2(0.97)  LDD1529  [8]
 LDCM0296  AC35 HEK-293T C2(1.07)  LDD1535  [8]
 LDCM0305  AC43 HEK-293T C2(1.03)  LDD1544  [8]
 LDCM0314  AC51 HEK-293T C2(1.11)  LDD1553  [8]
 LDCM0322  AC59 HEK-293T C2(1.04)  LDD1561  [8]
 LDCM0156  Aniline NCI-H1299 11.67  LDD0403  [1]
 LDCM0406  CL19 HEK-293T C2(0.96)  LDD1610  [8]
 LDCM0420  CL31 HEK-293T C2(0.95)  LDD1624  [8]
 LDCM0433  CL43 HEK-293T C2(1.13)  LDD1637  [8]
 LDCM0446  CL55 HEK-293T C2(1.00)  LDD1649  [8]
 LDCM0459  CL67 HEK-293T C2(0.97)  LDD1662  [8]
 LDCM0462  CL7 HEK-293T C2(0.96)  LDD1665  [8]
 LDCM0472  CL79 HEK-293T C2(0.97)  LDD1675  [8]
 LDCM0486  CL91 HEK-293T C2(0.99)  LDD1689  [8]
 LDCM0213  Electrophilic fragment 2 MDA-MB-231 C208(1.64); C299(0.90)  LDD1702  [4]
 LDCM0573  Fragment11 Ramos C83(8.16)  LDD2190  [9]
 LDCM0586  Fragment28 Ramos C83(0.53)  LDD2198  [9]
 LDCM0614  Fragment56 Ramos C83(1.85)  LDD2205  [9]
 LDCM0022  KB02 HEK-293T C208(0.96); C139(0.93); C247(1.31); C299(1.02)  LDD1492  [8]
 LDCM0023  KB03 HEK-293T C208(1.09); C139(0.88); C247(1.32); C299(0.99)  LDD1497  [8]
 LDCM0024  KB05 HMCB C308(0.98)  LDD3312  [3]
 LDCM0532  Nucleophilic fragment 29a MDA-MB-231 C208(0.78)  LDD2125  [4]
 LDCM0546  Nucleophilic fragment 40 MDA-MB-231 C208(1.10)  LDD2140  [4]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
General transcription and DNA repair factor IIH helicase subunit XPD (ERCC2) Helicase family P18074
Protein N-terminal glutamine amidohydrolase (NTAQ1) NTAQ1 family Q96HA8
E3 ubiquitin-protein ligase DZIP3 (DZIP3) . Q86Y13
Other
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein FAM43A (FAM43A) FAM43 family Q8N2R8
General transcription factor IIH subunit 3 (GTF2H3) TFB4 family Q13889

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
3 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
4 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
5 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
6 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
7 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
8 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
9 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578