Details of the Target
General Information of Target
| Target ID | LDTP14948 | |||||
|---|---|---|---|---|---|---|
| Target Name | Rho GTPase-activating protein 15 (ARHGAP15) | |||||
| Gene Name | ARHGAP15 | |||||
| Gene ID | 55843 | |||||
| Synonyms |
Rho GTPase-activating protein 15; ArhGAP15; Rho-type GTPase-activating protein 15 |
|||||
| 3D Structure | ||||||
| Sequence |
MALPGYPLGNVDDSRSKDSPAGEPQGQVPLTADVLAVSSSVASTDWQDIDQASFKTATPR
AISTSGDKDKSAVVPEHGQKTPRKITPLLPSQNPSPLQVSMSLQNPAWDRQVQDARTSQS LVVFPSHLLGKDKMSQMASVPEREPESAPSAPSAELQSTQHMEAQPVESDADHVTAGANG QHGPQAASTTKSAEEKAEHPKAPHPEAEALPSDESPVAMGANVVDSLGDLQTWFFPPPPA GSVSPSPGPHEVALGRRPLDSSLYTASEENSYMRSMTSLLDRGEGSISSLADILVWSETT MGMAIATGFLDSGHSTVADLLHSSGPSLRSVPSLVGSVSSAFSSGLVSGTSSALRTITRV LETVEQRTVEGIRSAMRYLTSHLTPRQAQADPNYD |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state. Has activity toward RAC1. Overexpression results in an increase in actin stress fibers and cell contraction.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K419(0.94) | LDD0277 | [1] | |
|
DBIA Probe Info |
![]() |
C197(1.56); C301(2.01) | LDD3334 | [2] | |
|
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
C197(0.00); C301(0.00) | LDD0038 | [3] | |
|
IA-alkyne Probe Info |
![]() |
C197(0.00); C301(0.00); C140(0.00) | LDD0036 | [3] | |
|
IPIAA_L Probe Info |
![]() |
N.A. | LDD0031 | [4] | |
|
Lodoacetamide azide Probe Info |
![]() |
C301(0.00); C140(0.00) | LDD0037 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C197(0.98) | LDD2187 | [5] |
| LDCM0572 | Fragment10 | Ramos | C197(1.61) | LDD2189 | [5] |
| LDCM0573 | Fragment11 | Ramos | C197(5.25) | LDD2190 | [5] |
| LDCM0574 | Fragment12 | Ramos | C197(1.01) | LDD2191 | [5] |
| LDCM0575 | Fragment13 | Ramos | C197(0.95) | LDD2192 | [5] |
| LDCM0576 | Fragment14 | Ramos | C197(1.46) | LDD2193 | [5] |
| LDCM0579 | Fragment20 | Ramos | C197(1.51) | LDD2194 | [5] |
| LDCM0580 | Fragment21 | Ramos | C197(0.86) | LDD2195 | [5] |
| LDCM0582 | Fragment23 | Ramos | C197(0.90) | LDD2196 | [5] |
| LDCM0578 | Fragment27 | Ramos | C197(0.85) | LDD2197 | [5] |
| LDCM0586 | Fragment28 | Ramos | C197(0.82) | LDD2198 | [5] |
| LDCM0588 | Fragment30 | Ramos | C197(1.02) | LDD2199 | [5] |
| LDCM0589 | Fragment31 | Ramos | C197(0.90) | LDD2200 | [5] |
| LDCM0590 | Fragment32 | Ramos | C197(2.23) | LDD2201 | [5] |
| LDCM0468 | Fragment33 | Ramos | C197(1.12) | LDD2202 | [5] |
| LDCM0596 | Fragment38 | Ramos | C197(0.86) | LDD2203 | [5] |
| LDCM0566 | Fragment4 | Ramos | C197(1.12) | LDD2184 | [5] |
| LDCM0610 | Fragment52 | Ramos | C197(1.24) | LDD2204 | [5] |
| LDCM0614 | Fragment56 | Ramos | C197(1.73) | LDD2205 | [5] |
| LDCM0569 | Fragment7 | Ramos | C197(0.24) | LDD2186 | [5] |
| LDCM0571 | Fragment9 | Ramos | C197(1.67) | LDD2188 | [5] |
| LDCM0022 | KB02 | T cell-activated | C287(5.09); C197(8.78) | LDD1704 | [6] |
| LDCM0023 | KB03 | Ramos | C197(1.04) | LDD2183 | [5] |
| LDCM0024 | KB05 | MOLM-16 | C197(1.56); C301(2.01) | LDD3334 | [2] |
References






