Details of the Target
General Information of Target
| Target ID | LDTP14863 | |||||
|---|---|---|---|---|---|---|
| Target Name | High mobility group nucleosome-binding domain-containing protein 3 (HMGN3) | |||||
| Gene Name | HMGN3 | |||||
| Gene ID | 9324 | |||||
| Synonyms |
TRIP7; High mobility group nucleosome-binding domain-containing protein 3; Thyroid receptor-interacting protein 7; TR-interacting protein 7; TRIP-7 |
|||||
| 3D Structure | ||||||
| Sequence |
MAAENSSFVTQFILAGLTDQPGVQIPLFFLFLGFYVVTVVGNLGLITLIRLNSHLHTPMY
FFLYNLSFIDFCYSSVITPKMLMSFVLKKNSISYAGCMTQLFFFLFFVVSESFILSAMAY DRYVAICNPLLYMVTMSPQVCFLLLLGVYGMGFAGAMAHTACMMGVTFCANNLVNHYMCD ILPLLECACTSTYVNELVVFVVVGIDIGVPTVTIFISYALILSSIFHIDSTEGRSKAFST CSSHIIAVSLFFGSGAFMYLKPFSLLAMNQGKVSSLFYTTVVPMLNPLIYSLRNKDVKVA LKKILNKNAFS |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
HMGN family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Binds to nucleosomes, regulating chromatin structure and consequently, chromatin-dependent processes such as transcription, DNA replication and DNA repair. Affects both insulin and glucagon levels and modulates the expression of pancreatic genes involved in insulin secretion. Regulates the expression of the glucose transporter SLC2A2 by binding specifically to its promoter region and recruiting PDX1 and additional transcription factors. Regulates the expression of SLC6A9, a glycine transporter which regulates the glycine concentration in synaptic junctions in the central nervous system, by binding to its transcription start site. May play a role in ocular development and astrocyte function.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C-Sul Probe Info |
![]() |
17.37 | LDD0066 | [1] | |
|
SF Probe Info |
![]() |
N.A. | LDD0028 | [2] | |
References


