Details of the Target
General Information of Target
Target ID | LDTP14615 | |||||
---|---|---|---|---|---|---|
Target Name | Thymosin beta-15B (TMSB15B) | |||||
Gene Name | TMSB15B | |||||
Gene ID | 11013 | |||||
Synonyms |
Thymosin beta-15B |
|||||
3D Structure | ||||||
Sequence |
MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS
|
|||||
Target Bioclass |
Other
|
|||||
Family |
Thymosin beta family
|
|||||
Subcellular location |
Cytoplasm, cytoskeleton
|
|||||
Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization. May be involved in cell migration. | |||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
W1 Probe Info |
![]() |
E33(2.18) | LDD0237 | [1] | |
Phosphinate-6 Probe Info |
![]() |
N.A. | LDD0018 | [2] |
Competitor(s) Related to This Target
References