Details of the Target
General Information of Target
| Target ID | LDTP14615 | |||||
|---|---|---|---|---|---|---|
| Target Name | Thymosin beta-15B (TMSB15B) | |||||
| Gene Name | TMSB15B | |||||
| Gene ID | 11013 | |||||
| Synonyms |
Thymosin beta-15B |
|||||
| 3D Structure | ||||||
| Sequence |
MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS
|
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Thymosin beta family
|
|||||
| Subcellular location |
Cytoplasm, cytoskeleton
|
|||||
| Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization. May be involved in cell migration. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
W1 Probe Info |
![]() |
E33(2.18) | LDD0237 | [1] | |
|
Phosphinate-6 Probe Info |
![]() |
N.A. | LDD0018 | [2] | |
Competitor(s) Related to This Target
References


