Details of the Target
General Information of Target
| Target ID | LDTP14529 | |||||
|---|---|---|---|---|---|---|
| Target Name | NADH dehydrogenase 1 beta subcomplex subunit 2, mitochondrial (NDUFB2) |
|
||||
| Gene Name | NDUFB2 | |||||
| Gene ID | 4708 | |||||
| Synonyms |
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial; Complex I-AGGG; CI-AGGG; NADH-ubiquinone oxidoreductase AGGG subunit |
|||||
| 3D Structure | ||||||
| Sequence |
MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRL
IYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Complex I NDUFB2 subunit family
|
|||||
| Subcellular location |
Mitochondrion inner membrane
|
|||||
| Function |
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C-Sul Probe Info |
 |
2.83 | LDD0066 | [1] | |
|
Crotonaldehyde Probe Info |
 |
N.A. | LDD0219 | [2] | |
The Interaction Atlas With This Target
References