Details of the Target
General Information of Target
| Target ID | LDTP14430 | |||||
|---|---|---|---|---|---|---|
| Target Name | G-protein coupled receptor 171 (GPR171) | |||||
| Gene Name | GPR171 | |||||
| Gene ID | 29909 | |||||
| Synonyms |
H963; G-protein coupled receptor 171; G-protein coupled receptor H963 |
|||||
| 3D Structure | ||||||
| Sequence |
MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCH
IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDT FGPGDDDEIQFDDIGDDDEDIDDI |
|||||
| Target Bioclass |
GPCR
|
|||||
| Family |
G-protein coupled receptor 1 family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
G-protein coupled receptor for Big LEN, a 16-amino acid neuropeptide produced from the precursor protein, proSAAS (encoded by PCSK1N). Acts through a G(i)-alpha-mediated pathway in response to Big LEN. Big LEN-GPR171 system plays an important role in regulating feeding and metabolism. Also plays a role in modulating fear and anxiety-like behaviors in the basolateral amygdala. Big LEN-GPR171 modulates the mu-type opioid receptor signaling and antinociception. Acts as a negative regulator T cell function.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
YY4-yne Probe Info |
 |
3.53 | LDD0400 | [1] | |
Competitor(s) Related to This Target