Details of the Target
General Information of Target
Target ID | LDTP14154 | |||||
---|---|---|---|---|---|---|
Target Name | Transient receptor potential cation channel subfamily V member 2 (TRPV2) | |||||
Gene Name | TRPV2 | |||||
Gene ID | 51393 | |||||
Synonyms |
VRL; Transient receptor potential cation channel subfamily V member 2; TrpV2; Osm-9-like TRP channel 2; OTRPC2; Vanilloid receptor-like protein 1; VRL-1 |
|||||
3D Structure | ||||||
Sequence |
MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDG
FLAFQTSRYKLHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVELVVKNPLCPLGQT VQSELFRSRLDSYVRSLPFFSARAG |
|||||
Target Type |
Literature-reported
|
|||||
Target Bioclass |
Transporter and channel
|
|||||
Family |
Transient receptor (TC 1.A.4) family, TrpV subfamily, TRPV2 sub-subfamily
|
|||||
Subcellular location |
Cell membrane
|
|||||
Function |
Calcium-permeable, non-selective cation channel with an outward rectification. Seems to be regulated, at least in part, by IGF-I, PDGF and neuropeptide head activator. May transduce physical stimuli in mast cells. Activated by temperatures higher than 52 degrees Celsius; is not activated by vanilloids and acidic pH.
|
|||||
TTD ID | ||||||
Uniprot ID | ||||||
DrugMap ID | ||||||
Ensemble ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
m-APA Probe Info |
![]() |
8.66 | LDD0402 | [1] | |
IPM Probe Info |
![]() |
N.A. | LDD0241 | [2] | |
DBIA Probe Info |
![]() |
C332(1.89) | LDD3325 | [3] | |
AHL-Pu-1 Probe Info |
![]() |
C156(2.55) | LDD0170 | [4] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0025 | 4SU-RNA | DM93 | C156(2.55) | LDD0170 | [4] |
LDCM0026 | 4SU-RNA+native RNA | DM93 | C722(2.01); C349(2.40) | LDD0171 | [4] |
LDCM0022 | KB02 | 22RV1 | C722(0.78) | LDD2243 | [3] |
LDCM0023 | KB03 | 22RV1 | C722(0.82) | LDD2660 | [3] |
LDCM0024 | KB05 | UACC257 | C332(1.89) | LDD3325 | [3] |
The Interaction Atlas With This Target
The Drug(s) Related To This Target
Approved
Drug Name | Drug Type | External ID | |||
---|---|---|---|---|---|
Cannabidiol | Small molecular drug | DB09061 |
Investigative
References