General Information of Target

Target ID LDTP14093
Target Name Receptor-interacting serine/threonine-protein kinase 3 (RIPK3)
Gene Name RIPK3
Gene ID 11035
Synonyms
RIP3; Receptor-interacting serine/threonine-protein kinase 3; EC 2.7.11.1; RIP-like protein kinase 3; Receptor-interacting protein 3; RIP-3
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYFESMEDVEVEN
ETGKDTFRVYKSGSEGPVLLLLHGGGHSALSWAVFTAAIISRVQCRIVALDLRSHGETKV
KNPEDLSAETMAKDVGNVVEAMYGDLPPPIMLIGHSMGGAIAVHTASSNLVPSLLGLCMI
DVVEGTAMDALNSMQNFLRGRPKTFKSLENAIEWSVKSGQIRNLESARVSMVGQVKQCEG
ITSPEGSKSIVEGIIEEEEEDEEGSESISKRKKEDDMETKKDHPYTWRIELAKTEKYWDG
WFRGLSNLFLSCPIPKLLLLAGVDRLDKDLTIGQMQGKFQMQVLPQCGHAVHEDAPDKVA
EAVATFLIRHRFAEPIGGFQCVFPGC
Target Bioclass
Enzyme
Family
Protein kinase superfamily, TKL Ser/Thr protein kinase family
Subcellular location
Cytoplasm, cytosol
Function
Serine/threonine-protein kinase that activates necroptosis and apoptosis, two parallel forms of cell death. Necroptosis, a programmed cell death process in response to death-inducing TNF-alpha family members, is triggered by RIPK3 following activation by ZBP1. Activated RIPK3 forms a necrosis-inducing complex and mediates phosphorylation of MLKL, promoting MLKL localization to the plasma membrane and execution of programmed necrosis characterized by calcium influx and plasma membrane damage. In addition to TNF-induced necroptosis, necroptosis can also take place in the nucleus in response to orthomyxoviruses infection: following ZBP1 activation, which senses double-stranded Z-RNA structures, nuclear RIPK3 catalyzes phosphorylation and activation of MLKL, promoting disruption of the nuclear envelope and leakage of cellular DNA into the cytosol. Also regulates apoptosis: apoptosis depends on RIPK1, FADD and CASP8, and is independent of MLKL and RIPK3 kinase activity. Phosphorylates RIPK1: RIPK1 and RIPK3 undergo reciprocal auto- and trans-phosphorylation. In some cell types, also able to restrict viral replication by promoting cell death-independent responses. In response to Zika virus infection in neurons, promotes a cell death-independent pathway that restricts viral replication: together with ZBP1, promotes a death-independent transcriptional program that modifies the cellular metabolism via up-regulation expression of the enzyme ACOD1/IRG1 and production of the metabolite itaconate. Itaconate inhibits the activity of succinate dehydrogenase, generating a metabolic state in neurons that suppresses replication of viral genomes. RIPK3 binds to and enhances the activity of three metabolic enzymes: GLUL, GLUD1, and PYGL. These metabolic enzymes may eventually stimulate the tricarboxylic acid cycle and oxidative phosphorylation, which could result in enhanced ROS production.; (Microbial infection) In case of herpes simplex virus 1/HHV-1 infection, forms heteromeric amyloid structures with HHV-1 protein RIR1/ICP6 which may inhibit RIPK3-mediated necroptosis, thereby preventing host cell death pathway and allowing viral evasion.
Uniprot ID
Q9Y572
Ensemble ID
ENST00000216274.10
HGNC ID
HGNC:10021
ChEMBL ID
CHEMBL1795199

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
AN3CA SNV: p.P439S .
HCT116 SNV: p.S103L .
KYSE150 SNV: p.A48T .
LS180 SNV: p.W434S .
MELHO SNV: p.E428D .
SBC5 SNV: p.V156F .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IA-alkyne
 Probe Info 
C234(6.29)  LDD1703  [1]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0625  F8 Ramos C234(0.71)  LDD2187  [2]
 LDCM0573  Fragment11 Ramos C234(1.68)  LDD2190  [2]
 LDCM0574  Fragment12 Ramos C234(2.40)  LDD2191  [2]
 LDCM0575  Fragment13 Ramos C234(1.04)  LDD2192  [2]
 LDCM0576  Fragment14 Ramos C365(0.79); C234(1.61)  LDD2193  [2]
 LDCM0580  Fragment21 Ramos C234(0.98)  LDD2195  [2]
 LDCM0582  Fragment23 Ramos C234(0.86)  LDD2196  [2]
 LDCM0578  Fragment27 Ramos C234(0.85)  LDD2197  [2]
 LDCM0586  Fragment28 Ramos C365(0.82)  LDD2198  [2]
 LDCM0588  Fragment30 Ramos C234(0.87)  LDD2199  [2]
 LDCM0589  Fragment31 Ramos C234(0.90)  LDD2200  [2]
 LDCM0468  Fragment33 Ramos C234(1.24)  LDD2202  [2]
 LDCM0596  Fragment38 Ramos C234(0.83)  LDD2203  [2]
 LDCM0566  Fragment4 Ramos C234(0.62)  LDD2184  [2]
 LDCM0610  Fragment52 Ramos C234(0.74)  LDD2204  [2]
 LDCM0614  Fragment56 Ramos C234(0.68)  LDD2205  [2]
 LDCM0569  Fragment7 Ramos C365(3.54); C234(1.35)  LDD2186  [2]
 LDCM0571  Fragment9 Ramos C234(0.99)  LDD2188  [2]
 LDCM0022  KB02 T cell C234(6.29)  LDD1703  [1]
 LDCM0023  KB03 Ramos C365(1.61); C234(1.42)  LDD2183  [2]
 LDCM0024  KB05 T cell C234(6.08)  LDD1705  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Baculoviral IAP repeat-containing protein 2 (BIRC2) IAP family Q13490
Baculoviral IAP repeat-containing protein 3 (BIRC3) IAP family Q13489
Receptor-interacting serine/threonine-protein kinase 1 (RIPK1) TKL Ser/Thr protein kinase family Q13546
Receptor-interacting serine/threonine-protein kinase 3 (RIPK3) TKL Ser/Thr protein kinase family Q9Y572
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Mixed lineage kinase domain-like protein (MLKL) Protein kinase superfamily Q8NB16
Other
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Z-DNA-binding protein 1 (ZBP1) . Q9H171

References

1 An Activity-Guided Map of Electrophile-Cysteine Interactions in Primary Human T Cells. Cell. 2020 Aug 20;182(4):1009-1026.e29. doi: 10.1016/j.cell.2020.07.001. Epub 2020 Jul 29.
2 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578