Details of the Target
General Information of Target
| Target ID | LDTP14088 | |||||
|---|---|---|---|---|---|---|
| Target Name | Intraflagellar transport protein 25 homolog (IFT25) | |||||
| Gene Name | IFT25 | |||||
| Gene ID | 51668 | |||||
| Synonyms |
C1orf41; HSPB11; Intraflagellar transport protein 25 homolog; Heat shock protein beta-11; Hspb11; Placental protein 25; PP25 |
|||||
| 3D Structure | ||||||
| Sequence |
MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVF
PGDGASHTKVHFRCVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKF DEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKK EAPYTLVGSISEPGLGLLSWWTSN |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
IFT25 family
|
|||||
| Subcellular location |
Cell projection, cilium
|
|||||
| Function |
Component of the IFT complex B required for sonic hedgehog/SHH signaling. May mediate transport of SHH components: required for the export of SMO and PTCH1 receptors out of the cilium and the accumulation of GLI2 at the ciliary tip in response to activation of the SHH pathway, suggesting it is involved in the dynamic transport of SHH signaling molecules within the cilium. Not required for ciliary assembly. Its role in intraflagellar transport is mainly seen in tissues rich in ciliated cells such as kidney and testis. Essential for male fertility, spermiogenesis and sperm flagella formation. Plays a role in the early development of the kidney. May be involved in the regulation of ureteric bud initiation.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K80(6.40) | LDD2218 | [1] | |
|
DBIA Probe Info |
![]() |
C52(1.06) | LDD3420 | [2] | |
|
m-APA Probe Info |
![]() |
H95(0.00); H108(0.00) | LDD2231 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0237 | AC12 | HEK-293T | C52(1.00) | LDD1510 | [4] |
| LDCM0280 | AC20 | HEK-293T | C52(1.17) | LDD1519 | [4] |
| LDCM0288 | AC28 | HEK-293T | C52(1.22) | LDD1527 | [4] |
| LDCM0297 | AC36 | HEK-293T | C52(0.95) | LDD1536 | [4] |
| LDCM0301 | AC4 | HEK-293T | C52(1.00) | LDD1540 | [4] |
| LDCM0306 | AC44 | HEK-293T | C52(1.02) | LDD1545 | [4] |
| LDCM0315 | AC52 | HEK-293T | C52(1.14) | LDD1554 | [4] |
| LDCM0324 | AC60 | HEK-293T | C52(1.08) | LDD1563 | [4] |
| LDCM0408 | CL20 | HEK-293T | C52(1.44) | LDD1612 | [4] |
| LDCM0421 | CL32 | HEK-293T | C52(1.50) | LDD1625 | [4] |
| LDCM0434 | CL44 | HEK-293T | C52(1.90) | LDD1638 | [4] |
| LDCM0447 | CL56 | HEK-293T | C52(1.21) | LDD1650 | [4] |
| LDCM0460 | CL68 | HEK-293T | C52(0.91) | LDD1663 | [4] |
| LDCM0473 | CL8 | HEK-293T | C52(1.53) | LDD1676 | [4] |
| LDCM0474 | CL80 | HEK-293T | C52(1.45) | LDD1677 | [4] |
| LDCM0487 | CL92 | HEK-293T | C52(1.29) | LDD1690 | [4] |
| LDCM0022 | KB02 | HEK-293T | C52(1.07) | LDD1492 | [4] |
| LDCM0023 | KB03 | HEK-293T | C52(0.98) | LDD1497 | [4] |
| LDCM0024 | KB05 | SHP-77 | C52(1.06) | LDD3420 | [2] |
References



