Details of the Target

General Information of Target

Target ID LDTP13803
Target Name Leucine zipper putative tumor suppressor 1 (LZTS1)
Gene Name LZTS1
Gene ID 11178
Synonyms
FEZ1; Leucine zipper putative tumor suppressor 1; F37/esophageal cancer-related gene-coding leucine-zipper motif; Fez1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRL
LPPEWMDVEKLEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDM
WDTRIAKLRVSADSFVRQQEAHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQPLEST
QSQDF
Target Bioclass
Transporter and channel
Family
LZTS family
Subcellular location
Cytoplasm
Function
Involved in the regulation of cell growth. May stabilize the active CDC2-cyclin B1 complex and thereby contribute to the regulation of the cell cycle and the prevention of uncontrolled cell proliferation. May act as a tumor suppressor.
Uniprot ID
Q9Y250
Ensemble ID
ENST00000265801.6
HGNC ID
HGNC:13861

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HCT15 SNV: p.Q334Ter .
HT115 SNV: p.N452D .
JURKAT SNV: p.S410N .
LNCaP clone FGC SNV: p.A499V .
MELJUSO SNV: p.L504R DBIA    Probe Info 
MFE319 SNV: p.E477G .
NCIH1155 SNV: p.G2D .
NCIH2172 SNV: p.R346P .
NCIH716 Insertion: p.S204KfsTer34 .
SHP77 SNV: p.E305D .
SNGM SNV: p.D234G .
SNU423 SNV: p.A74G .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IA-alkyne
 Probe Info  		C167(10.00)  LDD2157  [1]
DBIA
 Probe Info  		C450(1.01); C251(3.90); C385(2.50)  LDD3332  [2]
AHL-Pu-1
 Probe Info  		C385(2.65); C167(2.83)  LDD0171  [3]
HHS-475
 Probe Info  		Y542(0.95)  LDD0264  [4]
IPM
 Probe Info  		N.A.  LDD2156  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0026  4SU-RNA+native RNA DM93 C385(2.65); C167(2.83)  LDD0171  [3]
 LDCM0116  HHS-0101 DM93 Y542(0.95)  LDD0264  [4]
 LDCM0117  HHS-0201 DM93 Y542(0.82)  LDD0265  [4]
 LDCM0118  HHS-0301 DM93 Y542(0.96)  LDD0266  [4]
 LDCM0119  HHS-0401 DM93 Y542(0.85)  LDD0267  [4]
 LDCM0120  HHS-0701 DM93 Y542(1.00)  LDD0268  [4]
 LDCM0022  KB02 A101D C302(2.69); C167(2.85)  LDD2250  [2]
 LDCM0023  KB03 22RV1 C251(1.71)  LDD2660  [2]
 LDCM0024  KB05 MKN45 C450(1.01); C251(3.90); C385(2.50)  LDD3332  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 16 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
5'-AMP-activated protein kinase subunit beta-2 (PRKAB2) 5'-AMP-activated protein kinase beta subunit family O43741
Cell division cycle protein 23 homolog (CDC23) APC8/CDC23 family Q9UJX2
DNA-directed RNA polymerases I and III subunit RPAC1 (POLR1C) Archaeal Rpo3/eukaryotic RPB3 RNA polymerase subunit family O15160
Glutamine--tRNA ligase (QARS1) Class-I aminoacyl-tRNA synthetase family P47897
Probable ATP-dependent RNA helicase DDX6 (DDX6) DEAD box helicase family P26196
DNA-directed RNA polymerase III subunit RPC3 (POLR3C) Eukaryotic RPC3/POLR3C RNA polymerase subunit family Q9BUI4
Lysine-specific histone demethylase 1A (KDM1A) Flavin monoamine oxidase family O60341
Protein N-lysine methyltransferase METTL21A (METTL21A) METTL21 family Q8WXB1
M-phase inducer phosphatase 3 (CDC25C) MPI phosphatase family P30307
Histone acetyltransferase KAT5 (KAT5) MYST (SAS/MOZ) family Q92993
Protein N-terminal glutamine amidohydrolase (NTAQ1) NTAQ1 family Q96HA8
Proteasome subunit alpha type-1 (PSMA1) Peptidase T1A family P25786
Mitogen-activated protein kinase 9 (MAPK9) CMGC Ser/Thr protein kinase family P45984
Cell division cycle 7-related protein kinase (CDC7) Ser/Thr protein kinase family O00311
Kinesin-like protein KIF9 (KIF9) Kinesin family Q9HAQ2
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
Transporter and channel
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
AP-1 complex subunit mu-1 (AP1M1) Adaptor complexes medium subunit family Q9BXS5
Hsp90 co-chaperone Cdc37 (CDC37) CDC37 family Q16543
Exocyst complex component 8 (EXOC8) EXO84 family Q8IYI6
Sodium channel modifier 1 (SCNM1) . Q9BWG6
Synaptotagmin-like protein 4 (SYTL4) . Q96C24
TBC1 domain family member 1 (TBC1D1) . Q86TI0
Transcription factor
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein 3 (ZNF3) Krueppel C2H2-type zinc-finger protein family P17036
Zinc finger protein 35 (ZNF35) Krueppel C2H2-type zinc-finger protein family P13682
Zinc finger protein 417 (ZNF417) Krueppel C2H2-type zinc-finger protein family Q8TAU3
Zinc finger protein 572 (ZNF572) Krueppel C2H2-type zinc-finger protein family Q7Z3I7
Zinc finger protein 587 (ZNF587) Krueppel C2H2-type zinc-finger protein family Q96SQ5
Other
Click To Hide/Show 46 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Bystin (BYSL) Bystin family Q13895
Testis-specific gene 10 protein (TSGA10) CEP135/TSGA10 family Q9BZW7
Cyclin-dependent kinases regulatory subunit 1 (CKS1B) CKS family P61024
Conserved oligomeric Golgi complex subunit 2 (COG2) COG2 family Q14746
CWF19-like protein 2 (CWF19L2) CWF19 family Q2TBE0
Dynein regulatory complex subunit 4 (GAS8) DRC4 family O95995
Guanine nucleotide exchange factor MSS4 (RABIF) DSS4/MSS4 family P47224
Protein FAM161A (FAM161A) FAM161 family Q3B820
Protein FAM161B (FAM161B) FAM161 family Q96MY7
Protein FAM50B (FAM50B) FAM50 family Q9Y247
Protein FAM81B (FAM81B) FAM81 family Q96LP2
Protein FAM90A1 (FAM90A1) FAM90 family Q86YD7
Radial spoke head 14 homolog (RSPH14) Flagellar radial spoke RSP14 family Q9UHP6
Lamin-B2 (LMNB2) Intermediate filament family Q03252
Microfibrillar-associated protein 1 (MFAP1) MFAP1 family P55081
G-patch domain and KOW motifs-containing protein (GPKOW) MOS2 family Q92917
Pre-mRNA-splicing factor 18 (PRPF18) PRP18 family Q99633
Rhophilin-1 (RHPN1) RHPN family Q8TCX5
SAGA-associated factor 29 (SGF29) SGF29 family Q96ES7
U6 snRNA-associated Sm-like protein LSm2 (LSM2) SnRNP Sm proteins family Q9Y333
Speedy protein C (SPDYC) Speedy/Ringo family Q5MJ68
Suppressor of fused homolog (SUFU) SUFU family Q9UMX1
Synaptotagmin-17 (SYT17) Synaptotagmin family Q9BSW7
Alpha-taxilin (TXLNA) Taxilin family P40222
Beta-taxilin (TXLNB) Taxilin family Q8N3L3
Transcription elongation factor A protein 2 (TCEA2) TFS-II family Q15560
Tetratricopeptide repeat protein 9C (TTC9C) TTC9 family Q8N5M4
Coatomer subunit beta (COPB1) . P53618
Coiled-coil domain-containing protein 102B (CCDC102B) . Q68D86
Coiled-coil domain-containing protein 120 (CCDC120) . Q96HB5
Coiled-coil domain-containing protein 13 (CCDC13) . Q8IYE1
Elongin-A (ELOA) . Q14241
Enkurin domain-containing protein 1 (ENKD1) . Q9H0I2
Golgin subfamily A member 1 (GOLGA1) . Q92805
KN motif and ankyrin repeat domain-containing protein 2 (KANK2) . Q63ZY3
Leukocyte receptor cluster member 1 (LENG1) . Q96BZ8
LIM domain transcription factor LMO4 (LMO4) . P61968
Microspherule protein 1 (MCRS1) . Q96EZ8
Phostensin (PPP1R18) . Q6NYC8
PRKCA-binding protein (PICK1) . Q9NRD5
Rhombotin-1 (LMO1) . P25800
TBC1 domain family member 7 (TBC1D7) . Q9P0N9
Testis-specific protein 10-interacting protein (TSGA10IP) . Q3SY00
Thioredoxin domain-containing protein 9 (TXNDC9) . O14530
U4/U6 small nuclear ribonucleoprotein Prp3 (PRPF3) . O43395
Zinc finger MYND domain-containing protein 19 (ZMYND19) . Q96E35

References

1 From chemoproteomic-detected amino acids to genomic coordinates: insights into precise multi-omic data integration. Mol Syst Biol. 2021 Feb;17(2):e9840. doi: 10.15252/msb.20209840.
Mass spectrometry data entry: PXD022151
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
4 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
5 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019