Details of the Target
General Information of Target
| Target ID | LDTP13735 | |||||
|---|---|---|---|---|---|---|
| Target Name | Actin-binding protein WASF3 (WASF3) | |||||
| Gene Name | WASF3 | |||||
| Gene ID | 10810 | |||||
| Synonyms |
KIAA0900; SCAR3; WAVE3; Actin-binding protein WASF3; Protein WAVE-3; Verprolin homology domain-containing protein 3; Wiskott-Aldrich syndrome protein family member 3; WASP family protein member 3 |
|||||
| 3D Structure | ||||||
| Sequence |
MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGA
GIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGP LPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLN SMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFY YGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLS NAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHV RKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRP FKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIM SEKITRTLQIILEVVPEEDKL |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
SCAR/WAVE family
|
|||||
| Subcellular location |
Cytoplasm, cytoskeleton
|
|||||
| Function |
Downstream effector molecules involved in the transmission of signals from tyrosine kinase receptors and small GTPases to the actin cytoskeleton. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C28(0.79) | LDD3321 | [1] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0237 | AC12 | HEK-293T | C28(1.01) | LDD1510 | [3] |
| LDCM0280 | AC20 | HEK-293T | C28(0.90) | LDD1519 | [3] |
| LDCM0288 | AC28 | HEK-293T | C28(0.93) | LDD1527 | [3] |
| LDCM0297 | AC36 | HEK-293T | C28(0.93) | LDD1536 | [3] |
| LDCM0301 | AC4 | HEK-293T | C28(1.09) | LDD1540 | [3] |
| LDCM0306 | AC44 | HEK-293T | C28(0.93) | LDD1545 | [3] |
| LDCM0315 | AC52 | HEK-293T | C28(0.98) | LDD1554 | [3] |
| LDCM0324 | AC60 | HEK-293T | C28(0.96) | LDD1563 | [3] |
| LDCM0408 | CL20 | HEK-293T | C28(1.13) | LDD1612 | [3] |
| LDCM0421 | CL32 | HEK-293T | C28(1.06) | LDD1625 | [3] |
| LDCM0434 | CL44 | HEK-293T | C28(0.96) | LDD1638 | [3] |
| LDCM0447 | CL56 | HEK-293T | C28(1.14) | LDD1650 | [3] |
| LDCM0460 | CL68 | HEK-293T | C28(1.02) | LDD1663 | [3] |
| LDCM0473 | CL8 | HEK-293T | C28(1.04) | LDD1676 | [3] |
| LDCM0474 | CL80 | HEK-293T | C28(1.06) | LDD1677 | [3] |
| LDCM0487 | CL92 | HEK-293T | C28(0.98) | LDD1690 | [3] |
| LDCM0022 | KB02 | 22RV1 | C28(1.08) | LDD2243 | [1] |
| LDCM0023 | KB03 | 22RV1 | C28(1.10) | LDD2660 | [1] |
| LDCM0024 | KB05 | SH4 | C28(0.79) | LDD3321 | [1] |
References


