Details of the Target
General Information of Target
| Target ID | LDTP13625 | |||||
|---|---|---|---|---|---|---|
| Target Name | Ubl carboxyl-terminal hydrolase 18 (USP18) | |||||
| Gene Name | USP18 | |||||
| Gene ID | 11274 | |||||
| Synonyms |
ISG43; Ubl carboxyl-terminal hydrolase 18; EC 3.4.19.12; 43 kDa ISG15-specific protease; hUBP43; ISG15-specific-processing protease; Ubl thioesterase 18 |
|||||
| 3D Structure | ||||||
| Sequence |
MGTGDFICISMTGGAPWGFRLQGGKEQKQPLQVAKIRNQSKASGSGLCEGDEVVSINGNP
CADLTYPEVIKLMESITDSLQMLIKRPSSGISEALISENENKNLEHLTHGGYVESTTLQI RPATKTQCTEFFLAPVKTEVPLAENQRSGPDCAGSLKEETGPSYQRAPQMPDSQRGRVAE ELILREKVEAVQPGPVVELQLSLSQERHKGASGPLVALPGAEKSKSPDPDPNLSHDRIVH INSIPTNEKADPFLRSSKIIQISSGRELRVIQESEAGDAGLPRVEVILDCSDRQKTEGCR LQAGKECVDSPVEGGQSEAPPSLVSFAVSSEGTEQGEDPRSEKDHSRPHKHRARHARLRR SESLSEKQVKEAKSKCKSIALLLTDAPNPNSKGVLMFKKRRRRARKYTLVSYGTGELERE ADEEEEGDKEDTCEVAFLGASESEVDEELLSDVDDNTQVVNFDWDSGLVDIEKKLNRGDK MEMLPDTTGKGALMFAKRRERMDQITAQKEEDKVGGTPSREQDAAQTDGLRTTTSYQRKE EESVRTQSSVSKSYIEVSHGLGHVPQQNGFSGTSETANIQRMVPMNRTAKPFPGSVNQPA TPFSPTRNMTSPIADFPAPPPYSAVTPPPDAFSRGVSSPIAGPAQPPPWPQPAPWSQPAF YDSSERIASRDERISVPAKRTGILQEAKRRSTTKPMFTFKEPKVSPNPELLSLLQNSEGK RGTGAGGDSGPEEDYLSLGAEACNFMQSSSAKQKTPPPVAPKPAVKSSSSQPVTPVSPVW SPGVAPTQPPAFPTSNPSKGTVVSSIKIAQPSYPPARPASTLNVAGPFKGPQAAVASQNY TPKPTVSTPTVNAVQPGAVGPSNELPGMSGRGAQLFAKRQSRMEKYVVDSDTVQAHAARA QSPTPSLPASWKYSSNVRAPPPVAYNPIHSPSYPLAALKSQPSAAQPSKMGKKKGKKPLN ALDVMKHQPYQLNASLFTFQPPDAKDGLPQKSSVKVNSALAMKQALPPRPVNAASPTNVQ ASSVYSVPAYTSPPSFFAEASSPVSASPVPVGIPTSPKQESASSSYFVAPRPKFSAKKSG VTIQVWKPSVVEE |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Peptidase C19 family
|
|||||
| Subcellular location |
Cytoplasm; Nucleus
|
|||||
| Function |
Interferon-induced ISG15-specific protease that plays a crucial role for maintaining a proper balance of ISG15-conjugated proteins in cells. Regulates protein ISGylation by efficiently cleaving ISG15 conjugates linked via isopeptide bonds. Regulates T-cell activation and T-helper 17 (Th17) cell differentiation by deubiquitinating TAK1, likely to keep TAK1-TAB complexes in steady conditions. In turn, restricts activation of NF-kappa-B, NFAT, and JNK as well as expression of IL2 in T-cells after TCR activation. Acts as a molecular adapter with USP20 to promote innate antiviral response through deubiquitinating STING1. Involved also in the negative regulation of the inflammatory response triggered by type I interferon. Upon recruitment by STAT2 to the type I interferon receptor subunit IFNAR2 interferes with the assembly of the ternary interferon-IFNAR1-IFNAR2 complex and acts as a negative regulator of the type I interferon signaling pathway.; [Isoform 2]: Has enzymatic activity similar to isoform 1 and interferes with type I interferon signaling. Major deISGylation enzyme for nuclear proteins.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C126(2.94) | LDD3323 | [1] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0036 | [2] | |
|
Compound 10 Probe Info |
![]() |
N.A. | LDD2216 | [3] | |
|
TER-AC Probe Info |
![]() |
N.A. | LDD0426 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0270 | AC15 | HEK-293T | C228(1.01) | LDD1513 | [5] |
| LDCM0281 | AC21 | HEK-293T | C215(0.99) | LDD1520 | [5] |
| LDCM0283 | AC23 | HEK-293T | C228(1.01) | LDD1522 | [5] |
| LDCM0289 | AC29 | HEK-293T | C215(1.01) | LDD1528 | [5] |
| LDCM0292 | AC31 | HEK-293T | C228(0.96) | LDD1531 | [5] |
| LDCM0298 | AC37 | HEK-293T | C215(1.07) | LDD1537 | [5] |
| LDCM0300 | AC39 | HEK-293T | C228(0.96) | LDD1539 | [5] |
| LDCM0307 | AC45 | HEK-293T | C215(1.00) | LDD1546 | [5] |
| LDCM0309 | AC47 | HEK-293T | C228(1.06) | LDD1548 | [5] |
| LDCM0312 | AC5 | HEK-293T | C215(1.05) | LDD1551 | [5] |
| LDCM0316 | AC53 | HEK-293T | C215(1.08) | LDD1555 | [5] |
| LDCM0318 | AC55 | HEK-293T | C228(0.97) | LDD1557 | [5] |
| LDCM0325 | AC61 | HEK-293T | C215(1.07) | LDD1564 | [5] |
| LDCM0327 | AC63 | HEK-293T | C228(1.00) | LDD1566 | [5] |
| LDCM0334 | AC7 | HEK-293T | C228(1.02) | LDD1568 | [5] |
| LDCM0248 | AKOS034007472 | HEK-293T | C215(1.08) | LDD1511 | [5] |
| LDCM0379 | CL11 | HEK-293T | C228(1.10) | LDD1583 | [5] |
| LDCM0409 | CL21 | HEK-293T | C215(1.03) | LDD1613 | [5] |
| LDCM0411 | CL23 | HEK-293T | C228(1.02) | LDD1615 | [5] |
| LDCM0422 | CL33 | HEK-293T | C215(0.85) | LDD1626 | [5] |
| LDCM0424 | CL35 | HEK-293T | C228(1.01) | LDD1628 | [5] |
| LDCM0435 | CL45 | HEK-293T | C215(1.02) | LDD1639 | [5] |
| LDCM0437 | CL47 | HEK-293T | C228(1.19) | LDD1641 | [5] |
| LDCM0448 | CL57 | HEK-293T | C215(1.20) | LDD1651 | [5] |
| LDCM0450 | CL59 | HEK-293T | C228(1.31) | LDD1653 | [5] |
| LDCM0461 | CL69 | HEK-293T | C215(1.05) | LDD1664 | [5] |
| LDCM0464 | CL71 | HEK-293T | C228(1.10) | LDD1667 | [5] |
| LDCM0475 | CL81 | HEK-293T | C215(1.06) | LDD1678 | [5] |
| LDCM0477 | CL83 | HEK-293T | C228(1.23) | LDD1680 | [5] |
| LDCM0484 | CL9 | HEK-293T | C215(1.07) | LDD1687 | [5] |
| LDCM0488 | CL93 | HEK-293T | C215(0.94) | LDD1691 | [5] |
| LDCM0490 | CL95 | HEK-293T | C228(0.93) | LDD1693 | [5] |
| LDCM0022 | KB02 | DM93 | C126(1.34) | LDD2472 | [1] |
| LDCM0023 | KB03 | ICC12 | C130(1.91) | LDD2800 | [1] |
| LDCM0024 | KB05 | SKMEL24 | C126(2.94) | LDD3323 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| . | Peptidase C19 family | Q3LFD5 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Huntingtin (HTT) | Huntingtin family | P42858 | |||
Cytokine and receptor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Interferon alpha/beta receptor 2 (IFNAR2) | Type II cytokine receptor family | P48551 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Ubiquitin-like protein ISG15 (ISG15) | . | P05161 | |||
References




