Details of the Target
General Information of Target
| Target ID | LDTP13385 | |||||
|---|---|---|---|---|---|---|
| Target Name | Ras GTPase-activating protein nGAP (RASAL2) | |||||
| Gene Name | RASAL2 | |||||
| Gene ID | 9462 | |||||
| Synonyms |
NGAP; Ras GTPase-activating protein nGAP; RAS protein activator-like 2 |
|||||
| 3D Structure | ||||||
| Sequence |
MFNGEPGPASSGASRNVVRSSSISGEICGSQQAGGGAGTTTAKKRRSSLGAKMVAIVGLT
QWSKSTLQLPQPEGATKKLRSNIRRSTETGIAVEMRSRVTRQGSRESTDGSTNSNSSDGT FIFPTTRLGAESQFSDFLDGLGPAQIVGRQTLATPPMGDVHIAIMDRSGQLEVEVIEARG LTPKPGSKSLPATYIKVYLLENGACLAKKKTKMTKKTCDPLYQQALLFDEGPQGKVLQVI VWGDYGRMDHKCFMGMAQIMLDELDLSAAVTGWYKLFPTSSVADSTLGSLTRRLSQSSLE SATSPSCS |
|||||
| Target Bioclass |
Other
|
|||||
| Function | Inhibitory regulator of the Ras-cyclic AMP pathway. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K1029(0.77); K1107(5.51) | LDD0277 | [1] | |
|
DBIA Probe Info |
![]() |
C508(2.16); C591(3.64) | LDD3311 | [2] | |
|
NAIA_5 Probe Info |
![]() |
C443(20.00) | LDD2227 | [3] | |
|
AHL-Pu-1 Probe Info |
![]() |
C97(3.36) | LDD0170 | [4] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0162 | [5] | |
|
IPM Probe Info |
![]() |
C164(0.00); C443(0.00) | LDD0147 | [6] | |
|
TFBX Probe Info |
![]() |
C164(0.00); C443(0.00) | LDD0148 | [6] | |
|
AOyne Probe Info |
![]() |
13.60 | LDD0443 | [7] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0025 | 4SU-RNA | DM93 | C97(3.36) | LDD0170 | [4] |
| LDCM0026 | 4SU-RNA+native RNA | DM93 | C97(4.10) | LDD0171 | [4] |
| LDCM0632 | CL-Sc | Hep-G2 | C443(20.00) | LDD2227 | [3] |
| LDCM0213 | Electrophilic fragment 2 | MDA-MB-231 | C460(2.63); C415(1.61) | LDD1702 | [8] |
| LDCM0022 | KB02 | 786-O | C508(1.73); C591(2.23) | LDD2247 | [2] |
| LDCM0023 | KB03 | 769-P | C508(2.70) | LDD2663 | [2] |
| LDCM0024 | KB05 | G361 | C508(2.16); C591(3.64) | LDD3311 | [2] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Melanoma inhibitory activity protein 2 (MIA2) | MIA/OTOR family | Q96PC5 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Colorectal mutant cancer protein (MCC) | MCC family | P23508 | |||
| Harmonin-binding protein USHBP1 (USHBP1) | MCC family | Q8N6Y0 | |||
| TNF receptor-associated factor 1 (TRAF1) | . | Q13077 | |||
References








