Details of the Target

General Information of Target

Target ID LDTP13348
Target Name ATPase inhibitor, mitochondrial (ATP5IF1)
Gene Name ATP5IF1
Gene ID 93974
Synonyms
ATPI; ATPIF1; ATPase inhibitor, mitochondrial; ATP synthase F1 subunit epsilon; Inhibitor of F(1)F(o)-ATPase; IF(1); IF1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MVDHLLPVDENFSSPKCPVGYLGDRLVGRRAYHMLPSPVSEDDSDASSPCSCSSPDSQAL
CSCYGGGLGTESQDSILDFLLSQATLGSGGGSGSSIGASSGPVAWGPWRRAAAPVKGEHF
CLPEFPLGDPDDVPRPFQPTLEEIEEFLEENMEPGVKEVPEGNSKDLDACSQLSAGPHKS
HLHPGSSGRERCSPPPGGASAGGAQGPGGGPTPDGPIPVLLQIQPVPVKQESGTGPASPG
QAPENVKVAQLLVNIQGQTFALVPQVVPSSNLNLPSKFVRIAPVPIAAKPVGSGPLGPGP
AGLLMGQKFPKNPAAELIKMHKCTFPGCSKMYTKSSHLKAHLRRHTGEKPFACTWPGCGW
RFSRSDELSRHRRSHSGVKPYQCPVCEKKFARSDHLSKHIKVHRFPRSSRSVRSVN
Target Bioclass
Transporter and channel
Family
ATPase inhibitor family
Subcellular location
Mitochondrion
Function
Endogenous F(1)F(o)-ATPase inhibitor limiting ATP depletion when the mitochondrial membrane potential falls below a threshold and the F(1)F(o)-ATP synthase starts hydrolyzing ATP to pump protons out of the mitochondrial matrix. Required to avoid the consumption of cellular ATP when the F(1)F(o)-ATP synthase enzyme acts as an ATP hydrolase. Indirectly acts as a regulator of heme synthesis in erythroid tissues: regulates heme synthesis by modulating the mitochondrial pH and redox potential, allowing FECH to efficiently catalyze the incorporation of iron into protoporphyrin IX to produce heme.
Uniprot ID
Q9UII2
Ensemble ID
ENST00000335514.10
HGNC ID
HGNC:871

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
NUGC3 Insertion: p.H73TfsTer3 .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 14 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
TH211
 Probe Info  		Y58(15.82)  LDD0260  [1]
AZ-9
 Probe Info  		E55(1.18)  LDD2208  [2]
ONAyne
 Probe Info  		K49(0.00); K71(0.00); K82(0.00)  LDD0273  [3]
OPA-S-S-alkyne
 Probe Info  		K49(3.39); K90(6.67)  LDD3494  [4]
Probe 1
 Probe Info  		Y58(53.67)  LDD3495  [5]
HHS-465
 Probe Info  		Y58(10.00)  LDD2237  [6]
5E-2FA
 Probe Info  		H80(0.00); H73(0.00)  LDD2235  [7]
ATP probe
 Probe Info  		K71(0.00); K72(0.00)  LDD0199  [8]
m-APA
 Probe Info  		H80(0.00); H74(0.00); H73(0.00)  LDD2233  [7]
NHS
 Probe Info  		N.A.  LDD0010  [9]
SF
 Probe Info  		K49(0.00); K82(0.00)  LDD0028  [10]
STPyne
 Probe Info  		K72(0.00); K82(0.00)  LDD0009  [9]
Acrolein
 Probe Info  		H74(0.00); H73(0.00)  LDD0217  [11]
W1
 Probe Info  		N.A.  LDD0236  [12]
PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C338
 Probe Info  		10.34  LDD2001  [13]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0108  Chloroacetamide HeLa H74(0.00); H81(0.00); H80(0.00); H73(0.00)  LDD0222  [11]
 LDCM0107  IAA HeLa H74(0.00); H80(0.00); H73(0.00)  LDD0221  [11]
 LDCM0109  NEM HeLa H74(0.00); H81(0.00)  LDD0223  [11]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ATP synthase subunit beta, mitochondrial (ATP5F1B) ATPase alpha/beta chains family P06576
Fibroblast growth factor receptor 3 (FGFR3) Tyr protein kinase family P22607
GTPase HRas (HRAS) Ras family P01112
Kinesin-like protein KIF9 (KIF9) Kinesin family Q9HAQ2
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
mRNA export factor GLE1 (GLE1) GLE1 family Q53GS7
Nucleoporin p58/p45 (NUP58) NUP58 family Q9BVL2
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Krueppel-like factor 11 (KLF11) Sp1 C2H2-type zinc-finger protein family O14901
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Beta-2 adrenergic receptor (ADRB2) G-protein coupled receptor 1 family P07550
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Oncostatin-M-specific receptor subunit beta (OSMR) Type I cytokine receptor family Q99650
Other
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Alpha-2-macroglobulin (A2M) Protease inhibitor I39 (alpha-2-macroglobulin) family P01023
Gelsolin (GSN) Villin/gelsolin family P06396
Methyl-CpG-binding protein 2 (MECP2) . P51608
PRKCA-binding protein (PICK1) . Q9NRD5
Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) . Q7Z699

References

1 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
2 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
3 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
4 A chemical proteomics approach for global mapping of functional lysines on cell surface of living cell. Nat Commun. 2024 Apr 8;15(1):2997. doi: 10.1038/s41467-024-47033-w.
Mass spectrometry data entry: PXD042888
5 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
6 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
7 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
8 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
9 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
10 Solid Phase Synthesis of Fluorosulfate Containing Macrocycles for Chemoproteomic Workflows. bioRxiv [Preprint]. 2023 Feb 18:2023.02.17.529022. doi: 10.1101/2023.02.17.529022.
Mass spectrometry data entry: PXD039931
11 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
12 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
13 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587