Details of the Target
General Information of Target
| Target ID | LDTP13315 | |||||
|---|---|---|---|---|---|---|
| Target Name | Fasciculation and elongation protein zeta-2 (FEZ2) | |||||
| Gene Name | FEZ2 | |||||
| Gene ID | 9637 | |||||
| Synonyms |
Fasciculation and elongation protein zeta-2; Zygin II; Zygin-2 |
|||||
| 3D Structure | ||||||
| Sequence |
MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLR
KQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRA AFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHF DTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTD DEKTYYSLITSFSELYLPSST |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Zygin family
|
|||||
| Function | Involved in axonal outgrowth and fasciculation. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C61(1.86) | LDD3413 | [1] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0162 | [2] | |
|
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [3] | |
|
AOyne Probe Info |
![]() |
15.00 | LDD0443 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0259 | AC14 | HEK-293T | C61(0.83) | LDD1512 | [5] |
| LDCM0282 | AC22 | HEK-293T | C61(0.79) | LDD1521 | [5] |
| LDCM0291 | AC30 | HEK-293T | C61(0.92) | LDD1530 | [5] |
| LDCM0299 | AC38 | HEK-293T | C61(0.85) | LDD1538 | [5] |
| LDCM0308 | AC46 | HEK-293T | C61(1.00) | LDD1547 | [5] |
| LDCM0317 | AC54 | HEK-293T | C61(1.07) | LDD1556 | [5] |
| LDCM0323 | AC6 | HEK-293T | C61(0.99) | LDD1562 | [5] |
| LDCM0326 | AC62 | HEK-293T | C61(1.03) | LDD1565 | [5] |
| LDCM0368 | CL10 | HEK-293T | C61(0.82) | LDD1572 | [5] |
| LDCM0410 | CL22 | HEK-293T | C61(0.72) | LDD1614 | [5] |
| LDCM0423 | CL34 | HEK-293T | C61(0.67) | LDD1627 | [5] |
| LDCM0436 | CL46 | HEK-293T | C61(0.76) | LDD1640 | [5] |
| LDCM0449 | CL58 | HEK-293T | C61(0.76) | LDD1652 | [5] |
| LDCM0463 | CL70 | HEK-293T | C61(0.88) | LDD1666 | [5] |
| LDCM0476 | CL82 | HEK-293T | C61(0.85) | LDD1679 | [5] |
| LDCM0489 | CL94 | HEK-293T | C61(0.80) | LDD1692 | [5] |
| LDCM0022 | KB02 | IPC-298 | C61(1.71) | LDD2400 | [1] |
| LDCM0023 | KB03 | IPC-298 | C61(2.05) | LDD2817 | [1] |
| LDCM0024 | KB05 | RVH-421 | C61(1.86) | LDD3413 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Huntingtin (HTT) | Huntingtin family | P42858 | |||
| Alpha-synuclein (SNCA) | Synuclein family | P37840 | |||
| Wolframin (WFS1) | . | O76024 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Ataxin-1 (ATXN1) | ATXN1 family | P54253 | |||
| Survival motor neuron protein (SMN1; SMN2) | SMN family | Q16637 | |||
References




