Details of the Target
General Information of Target
Target ID | LDTP13129 | |||||
---|---|---|---|---|---|---|
Target Name | Phosphatidylethanolamine N-methyltransferase (PEMT) | |||||
Gene Name | PEMT | |||||
Gene ID | 10400 | |||||
Synonyms |
PEMPT; PNMT; Phosphatidylethanolamine N-methyltransferase; PEAMT; PEMT; EC 2.1.1.17; EC 2.1.1.71; PEMT2; Phospholipid methyltransferase; PLMT |
|||||
3D Structure | ||||||
Sequence |
MAAAQPKYPAGATARRLARGCWSALWDYETPKVIVVRNRRLGVLYRAVQLLILLYFVWYV
FIVQKSYQESETGPESSIITKVKGITTSEHKVWDVEEYVKPPEGGSVFSIITRVEATHSQ TQGTCPESIRVHNATCLSDADCVAGELDMLGNGLRTGRCVPYYQGPSKTCEVFGWCPVED GASVSQFLGTMAPNFTILIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFK LGFIVEKAGESFTELAHKGGVIGVIINWDCDLDLPASECNPKYSFRRLDPKHVPASSGYN FRFAKYYKINGTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSVGVGSFLCD WILLTFMNKNKVYSHKKFDKVCTPSHPSGSWPVTLARVLGQAPPEPGHRSEDQHPSPPSG QEGQQGAECGPAFPPLRPCPISAPSEQMVDTPASEPAQASTPTDPKGLAQL |
|||||
Target Type |
Literature-reported
|
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
Class VI-like SAM-binding methyltransferase superfamily, PEMT/PEM2 methyltransferase family
|
|||||
Subcellular location |
Endoplasmic reticulum membrane; Endoplasmic reticulum
|
|||||
Function |
Catalyzes the three sequential steps of the methylation pathway for the biosynthesis of phosphatidylcholine, a critical and essential component for membrane structure. Uses S-adenosylmethionine (S-adenosyl-L-methionine, SAM or AdoMet) as the methyl group donor for the methylation of phosphatidylethanolamine (1,2-diacyl-sn-glycero-3-phosphoethanolamine, PE) to phosphatidylmonomethylethanolamine (1,2-diacyl-sn-glycero-3-phospho-N-methylethanolamine, PMME), PMME to phosphatidyldimethylethanolamine (1,2-diacyl-sn-glycero-3-phospho-N,N-dimethylethanolamine, PDME), and PDME to phosphatidylcholine (1,2-diacyl-sn-glycero-3-phosphocholine, PC), producing S-adenosyl-L-homocysteine in each step. Responsible for approximately 30% of hepatic PC with the CDP-choline pathway accounting for the other 70% (Probable).; [Isoform 1]: Catalyzes the three sequential steps of the methylation of 1,2-diacyl-sn-glycero-3-phospho-N-methylethanolamine (PMME) to 1,2-diacyl-sn-glycero-3-phospho-N,N-dimethylethanolamine (PDME) more efficiently than isoform 2. Induces increase in PC species with longer polyunsaturated chains than isoform 2.; [Isoform 2]: Produces a higher increase in the level of PC species containing long chains with three double bonds than isoform 1.
|
|||||
TTD ID | ||||||
Uniprot ID | ||||||
DrugMap ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
STPyne Probe Info |
![]() |
K38(5.91) | LDD0277 | [1] | |
IA-alkyne Probe Info |
![]() |
C70(1.32) | LDD2182 | [2] | |
Lodoacetamide azide Probe Info |
![]() |
N.A. | LDD0037 | [3] | |
TFBX Probe Info |
![]() |
N.A. | LDD0027 | [4] | |
IPM Probe Info |
![]() |
N.A. | LDD0005 | [5] | |
NAIA_5 Probe Info |
![]() |
C53(0.00); C70(0.00) | LDD2223 | [6] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0213 | Electrophilic fragment 2 | MDA-MB-231 | C70(1.55) | LDD1702 | [7] |
LDCM0625 | F8 | Ramos | C70(0.81) | LDD2187 | [2] |
LDCM0575 | Fragment13 | Ramos | C70(0.44) | LDD2192 | [2] |
LDCM0576 | Fragment14 | Ramos | C70(1.69) | LDD2193 | [2] |
LDCM0580 | Fragment21 | Ramos | C70(1.83) | LDD2195 | [2] |
LDCM0582 | Fragment23 | Ramos | C70(1.13) | LDD2196 | [2] |
LDCM0578 | Fragment27 | Ramos | C70(0.99) | LDD2197 | [2] |
LDCM0586 | Fragment28 | Ramos | C70(1.53) | LDD2198 | [2] |
LDCM0588 | Fragment30 | Ramos | C70(0.47) | LDD2199 | [2] |
LDCM0589 | Fragment31 | Ramos | C70(0.63) | LDD2200 | [2] |
LDCM0468 | Fragment33 | Ramos | C70(0.84) | LDD2202 | [2] |
LDCM0596 | Fragment38 | Ramos | C70(4.40) | LDD2203 | [2] |
LDCM0614 | Fragment56 | Ramos | C70(1.41) | LDD2205 | [2] |
LDCM0022 | KB02 | Ramos | C70(1.32) | LDD2182 | [2] |
LDCM0627 | NUDT7-COV-1 | HEK-293T | C70(1.03) | LDD2206 | [8] |
LDCM0628 | OTUB2-COV-1 | HEK-293T | C70(0.64) | LDD2207 | [8] |
The Interaction Atlas With This Target
References