General Information of Target

Target ID LDTP12938
Target Name Leucine-rich repeat transmembrane protein FLRT3 (FLRT3)
Gene Name FLRT3
Gene ID 23767
Synonyms
KIAA1469; Leucine-rich repeat transmembrane protein FLRT3; Fibronectin-like domain-containing leucine-rich transmembrane protein 3
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDG
DGEISFQEFLTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELD
AMIREADVDQDGRVNYEEFARMLAQE
Target Bioclass
Transporter and channel
Subcellular location
Cell membrane
Function
Functions in cell-cell adhesion, cell migration and axon guidance, exerting an attractive or repulsive role depending on its interaction partners. Plays a role in the spatial organization of brain neurons. Plays a role in vascular development in the retina. Plays a role in cell-cell adhesion via its interaction with ADGRL3 and probably also other latrophilins that are expressed at the surface of adjacent cells. Interaction with the intracellular domain of ROBO1 mediates axon attraction towards cells expressing NTN1. Mediates axon growth cone collapse and plays a repulsive role in neuron guidance via its interaction with UNC5B, and possibly also other UNC-5 family members. Promotes neurite outgrowth (in vitro). Mediates cell-cell contacts that promote an increase both in neurite number and in neurite length. Plays a role in the regulation of the density of glutamaergic synapses. Plays a role in fibroblast growth factor-mediated signaling cascades. Required for normal morphogenesis during embryonic development, but not for normal embryonic patterning. Required for normal ventral closure, headfold fusion and definitive endoderm migration during embryonic development. Required for the formation of a normal basement membrane and the maintenance of a normal anterior visceral endoderm during embryonic development.
Uniprot ID
Q9NZU0
Ensemble ID
ENST00000341420.5
HGNC ID
HGNC:3762

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
TG42
 Probe Info 
8.75  LDD0326  [1]
DBIA
 Probe Info 
C355(1.98)  LDD3369  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 A2058 C334(3.08)  LDD2253  [2]
 LDCM0023  KB03 A2058 C334(6.07)  LDD2670  [2]
 LDCM0024  KB05 OAW-42 C355(1.98)  LDD3369  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Adhesion G protein-coupled receptor L3 (ADGRL3) G-protein coupled receptor 2 family Q9HAR2

References

1 Design and synthesis of tailored human caseinolytic protease P inhibitors. Chem Commun (Camb). 2018 Aug 28;54(70):9833-9836. doi: 10.1039/c8cc05265d.
Mass spectrometry data entry: PXD010277
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840