Details of the Target
General Information of Target
Target ID | LDTP12938 | |||||
---|---|---|---|---|---|---|
Target Name | Leucine-rich repeat transmembrane protein FLRT3 (FLRT3) | |||||
Gene Name | FLRT3 | |||||
Gene ID | 23767 | |||||
Synonyms |
KIAA1469; Leucine-rich repeat transmembrane protein FLRT3; Fibronectin-like domain-containing leucine-rich transmembrane protein 3 |
|||||
3D Structure | ||||||
Sequence |
MAGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDG
DGEISFQEFLTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELD AMIREADVDQDGRVNYEEFARMLAQE |
|||||
Target Bioclass |
Transporter and channel
|
|||||
Subcellular location |
Cell membrane
|
|||||
Function |
Functions in cell-cell adhesion, cell migration and axon guidance, exerting an attractive or repulsive role depending on its interaction partners. Plays a role in the spatial organization of brain neurons. Plays a role in vascular development in the retina. Plays a role in cell-cell adhesion via its interaction with ADGRL3 and probably also other latrophilins that are expressed at the surface of adjacent cells. Interaction with the intracellular domain of ROBO1 mediates axon attraction towards cells expressing NTN1. Mediates axon growth cone collapse and plays a repulsive role in neuron guidance via its interaction with UNC5B, and possibly also other UNC-5 family members. Promotes neurite outgrowth (in vitro). Mediates cell-cell contacts that promote an increase both in neurite number and in neurite length. Plays a role in the regulation of the density of glutamaergic synapses. Plays a role in fibroblast growth factor-mediated signaling cascades. Required for normal morphogenesis during embryonic development, but not for normal embryonic patterning. Required for normal ventral closure, headfold fusion and definitive endoderm migration during embryonic development. Required for the formation of a normal basement membrane and the maintenance of a normal anterior visceral endoderm during embryonic development.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
TG42 Probe Info |
![]() |
8.75 | LDD0326 | [1] | |
DBIA Probe Info |
![]() |
C355(1.98) | LDD3369 | [2] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References