Details of the Target
General Information of Target
Target ID | LDTP12523 | |||||
---|---|---|---|---|---|---|
Target Name | Serine/threonine-protein kinase LATS2 (LATS2) | |||||
Gene Name | LATS2 | |||||
Gene ID | 26524 | |||||
Synonyms |
KPM; Serine/threonine-protein kinase LATS2; EC 2.7.11.1; Kinase phosphorylated during mitosis protein; Large tumor suppressor homolog 2; Serine/threonine-protein kinase kpm; Warts-like kinase |
|||||
3D Structure | ||||||
Sequence |
MSLVLLSLAALCRSAVPREPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATG
DYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWT FSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPGCLDHIMKYKKKCVKAGSLW DPNITACKKNEETVEVNFTTTPLGNRYMALIQHSTIIGFSQVFEPHQKKQTRASVVIPVT GDSEGATVQLTPYFPTCGSDCIRHKGTVVLCPQTGVPFPLDNNKSKPGGWLPLLLLSLLV ATWVLVAGIYLMWRHERIKKTSFSTTTLLPPIKVLVVYPSEICFHHTICYFTEFLQNHCR SEVILEKWQKKKIAEMGPVQWLATQKKAADKVVFLLSNDVNSVCDGTCGKSEGSPSENSQ DLFPLAFNLFCSDLRSQIHLHKYVVVYFREIDTKDDYNALSVCPKYHLMKDATAFCAELL HVKQQVSAGKRSQACHDGCCSL |
|||||
Target Type |
Literature-reported
|
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
Protein kinase superfamily, AGC Ser/Thr protein kinase family
|
|||||
Subcellular location |
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome
|
|||||
Function |
Negative regulator of YAP1 in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Acts as a tumor suppressor which plays a critical role in centrosome duplication, maintenance of mitotic fidelity and genomic stability. Negatively regulates G1/S transition by down-regulating cyclin E/CDK2 kinase activity. Negative regulator of the androgen receptor. Phosphorylates SNAI1 in the nucleus leading to its nuclear retention and stabilization, which enhances its epithelial-mesenchymal transition and tumor cell invasion/migration activities. This tumor-promoting activity is independent of its effects upon YAP1 or WWTR1/TAZ.
|
|||||
TTD ID | ||||||
Uniprot ID | ||||||
DrugMap ID | ||||||
Ensemble ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C905(1.96) | LDD3368 | [1] | |
IA-alkyne Probe Info |
![]() |
C112(9.98) | LDD0371 | [2] | |
AMP probe Probe Info |
![]() |
N.A. | LDD0200 | [3] | |
ATP probe Probe Info |
![]() |
N.A. | LDD0199 | [3] | |
NAIA_5 Probe Info |
![]() |
C850(0.00); C813(0.00) | LDD2225 | [4] | |
IPM Probe Info |
![]() |
C637(0.00); C813(0.00) | LDD2156 | [5] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0025 | 4SU-RNA | HEK-293T | C112(9.98) | LDD0371 | [2] |
LDCM0026 | 4SU-RNA+native RNA | HEK-293T | C112(7.60) | LDD0372 | [2] |
LDCM0632 | CL-Sc | Hep-G2 | C813(0.33) | LDD2227 | [4] |
LDCM0022 | KB02 | A204 | C905(2.28) | LDD2252 | [1] |
LDCM0023 | KB03 | A204 | C905(2.19) | LDD2669 | [1] |
LDCM0024 | KB05 | OAW-28 | C905(1.96) | LDD3368 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
E3 ubiquitin-protein ligase SIAH2 (SIAH2) | SINA (Seven in absentia) family | O43255 | |||
DDB1- and CUL4-associated factor 1 (DCAF1) | VPRBP/DCAF1 family | Q9Y4B6 |
Other
References