Details of the Target
General Information of Target
| Target ID | LDTP12484 | |||||
|---|---|---|---|---|---|---|
| Target Name | Potassium voltage-gated channel subfamily KQT member 5 (KCNQ5) | |||||
| Gene Name | KCNQ5 | |||||
| Gene ID | 56479 | |||||
| Synonyms |
Potassium voltage-gated channel subfamily KQT member 5; KQT-like 5; Potassium channel subunit alpha KvLQT5; Voltage-gated potassium channel subunit Kv7.5 |
|||||
| 3D Structure | ||||||
| Sequence |
MVAKDYPFYLTVKRANCSLELPPASGPAKDAEEPSNKRVKPLSRVTSLANLIPPVKATPL
KRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKE IKRQEAIFELSQGEEDLIEDLKLAKKAYHDPMLKLSIMTEQELNQIFGTLDSLIPLHEEL LSQLRDVRKPDGSTEHVGPILVGWLPCLSSYDSYCSNQVAAKALLDHKKQDHRVQDFLQR CLESPFSRKLDLWNFLDIPRSRLVKYPLLLREILRHTPNDNPDQQHLEEAINIIQGIVAE INTKTGESECRYYKERLLYLEEGQKDSLIDSSRVLCCHGELKNNRGVKLHVFLFQEVLVI TRAVTHNEQLCYQLYRQPIPVKDLLLEDLQDGEVRLGGSLRGAFSNNERIKNFFRVSFKN GSQSQTHSLQANDTFNKQQWLNCIRQAKETVLCAAGQAGVLDSEGSFLNPTTGSRELQGE TKLEQMDQSDSESDCSMDTSEVSLDCERMEQTDSSCGNSRHGESNV |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Potassium channel family, KQT (TC 1.A.1.15) subfamily, Kv7.5/KCNQ5 sub-subfamily
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Associates with KCNQ3 to form a potassium channel which contributes to M-type current, a slowly activating and deactivating potassium conductance which plays a critical role in determining the subthreshold electrical excitability of neurons. Therefore, it is important in the regulation of neuronal excitability. May contribute, with other potassium channels, to the molecular diversity of a heterogeneous population of M-channels, varying in kinetic and pharmacological properties, which underlie this physiologically important current. Insensitive to tetraethylammonium, but inhibited by barium, linopirdine and XE991. Activated by niflumic acid and the anticonvulsant retigabine. As the native M-channel, the potassium channel composed of KCNQ3 and KCNQ5 is also suppressed by activation of the muscarinic acetylcholine receptor CHRM1.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| C32 | SNV: p.T97P | . | |||
| COLO320 | SNV: p.L47M Substitution: p.Q112G |
. | |||
| DETROIT562 | SNV: p.T392A | . | |||
| DU145 | SNV: p.R244H | . | |||
| HCT15 | SNV: p.R244C | . | |||
| HT115 | SNV: p.A182V; p.R426C | . | |||
| HT1197 | SNV: p.H4N Substitution: p.A14C |
. | |||
| IM95 | SNV: p.R244C | . | |||
| IPC298 | SNV: p.E385D | . | |||
| MCC13 | SNV: p.R187Q; p.G273E; p.K408I | . | |||
| MCC26 | SNV: p.A899V | . | |||
| MELJUSO | SNV: p.K107Q | DBIA Probe Info | |||
| NCIH196 | SNV: p.A332E | . | |||
| NUGC3 | SNV: p.S416I | . | |||
| PF382 | SNV: p.A725V | . | |||
| SISO | SNV: p.C507Y | . | |||
| SKMEL28 | SNV: p.S724L | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C641(2.52); C934(2.11) | LDD3332 | [1] | |
|
AHL-Pu-1 Probe Info |
 |
C915(2.96) | LDD0170 | [2] | |
|
IPM Probe Info |
 |
C915(2.31) | LDD1701 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0025 | 4SU-RNA | DM93 | C915(2.96) | LDD0170 | [2] |
| LDCM0026 | 4SU-RNA+native RNA | DM93 | C819(2.17); C622(2.66) | LDD0171 | [2] |
| LDCM0022 | KB02 | A101D | C934(1.95) | LDD2250 | [1] |
| LDCM0023 | KB03 | MDA-MB-231 | C915(2.31) | LDD1701 | [3] |
| LDCM0024 | KB05 | MKN45 | C641(2.52); C934(2.11) | LDD3332 | [1] |
The Interaction Atlas With This Target
The Drug(s) Related To This Target
Approved
Investigative
References