Details of the Target

General Information of Target

Target ID LDTP12353
Target Name Carbohydrate sulfotransferase 11 (CHST11)
Gene Name CHST11
Gene ID 50515
Synonyms
Carbohydrate sulfotransferase 11; EC 2.8.2.5; Chondroitin 4-O-sulfotransferase 1; Chondroitin 4-sulfotransferase 1; C4S-1; C4ST-1; C4ST1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSGGWMAQVGAWRTGALGLALLLLLGLGLGLEAAASPLSTPTSAQAAGPSSGSCPPTKFQ
CRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGT
DKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATT
MGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVIAAAAVLSA
SLVTATLLLLSWLRAQERLRPLGLLVAMKESLLLSEQKTSLP
Target Bioclass
Enzyme
Family
Sulfotransferase 2 family
Subcellular location
Golgi apparatus membrane
Function
Catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. Can also sulfate Gal residues in desulfated dermatan sulfate. Preferentially sulfates in GlcA->GalNAc unit than in IdoA->GalNAc unit. Does not form 4, 6-di-O-sulfated GalNAc when chondroitin sulfate C is used as an acceptor.
Uniprot ID
Q9NPF2
Ensemble ID
ENST00000303694.6
HGNC ID
HGNC:17422

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
FADU SNV: p.Q291L .
HEC1 SNV: p.R100M .
HT SNV: p.D285G .
MCC26 SNV: p.D87N .
MFE319 SNV: p.E239G .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
TH211
 Probe Info  		Y64(10.00)  LDD0260  [1]
DBIA
 Probe Info  		C128(5.42)  LDD0209  [2]
4-Iodoacetamidophenylacetylene
 Probe Info  		N.A.  LDD0038  [3]
Lodoacetamide azide
 Probe Info  		C128(0.00); C89(0.00)  LDD0037  [3]
IPM
 Probe Info  		N.A.  LDD0005  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0369  CL100 HEK-293T C89(0.74)  LDD1573  [5]
 LDCM0373  CL104 HEK-293T C89(1.28)  LDD1577  [5]
 LDCM0377  CL108 HEK-293T C89(1.02)  LDD1581  [5]
 LDCM0382  CL112 HEK-293T C89(0.83)  LDD1586  [5]
 LDCM0386  CL116 HEK-293T C89(1.03)  LDD1590  [5]
 LDCM0391  CL120 HEK-293T C89(1.15)  LDD1595  [5]
 LDCM0395  CL124 HEK-293T C89(0.98)  LDD1599  [5]
 LDCM0399  CL128 HEK-293T C89(1.44)  LDD1603  [5]
 LDCM0403  CL16 HEK-293T C89(1.08)  LDD1607  [5]
 LDCM0416  CL28 HEK-293T C89(0.93)  LDD1620  [5]
 LDCM0429  CL4 HEK-293T C89(1.37)  LDD1633  [5]
 LDCM0430  CL40 HEK-293T C89(1.15)  LDD1634  [5]
 LDCM0443  CL52 HEK-293T C89(1.22)  LDD1646  [5]
 LDCM0456  CL64 HEK-293T C89(0.81)  LDD1659  [5]
 LDCM0469  CL76 HEK-293T C89(0.94)  LDD1672  [5]
 LDCM0482  CL88 HEK-293T C89(1.10)  LDD1685  [5]
 LDCM0213  Electrophilic fragment 2 MDA-MB-231 C89(2.45)  LDD1702  [6]
 LDCM0022  KB02 A101D C89(2.34)  LDD2250  [7]
 LDCM0023  KB03 Jurkat C128(5.42)  LDD0209  [2]
 LDCM0024  KB05 UACC257 C89(1.11)  LDD3325  [7]

References

1 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
2 Covalent Inhibition by a Natural Product-Inspired Latent Electrophile. J Am Chem Soc. 2023 May 24;145(20):11097-11109. doi: 10.1021/jacs.3c00598. Epub 2023 May 15.
3 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
4 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
5 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
6 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
7 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840