Details of the Target
General Information of Target
| Target ID | LDTP12065 | |||||
|---|---|---|---|---|---|---|
| Target Name | MOB kinase activator 1A (MOB1A) | |||||
| Gene Name | MOB1A | |||||
| Gene ID | 55233 | |||||
| Synonyms |
C2orf6; MOB4B; MOBK1B; MOBKL1B; MOB kinase activator 1A; Mob1 alpha; Mob1A; Mob1 homolog 1B; Mps one binder kinase activator-like 1B |
|||||
| 3D Structure | ||||||
| Sequence |
MAPWAEAEHSALNPLRAVWLTLTAAFLLTLLLQLLPPGLLPGCAIFQDLIRYGKTKCGEP
SRPAACRAFDVPKRYFSHFYIISVLWNGFLLWCLTQSLFLGAPFPSWLHGLLRILGAAQF QGGELALSAFLVLVFLWLHSLRRLFECLYVSVFSNVMIHVVQYCFGLVYYVLVGLTVLSQ VPMDGRNAYITGKNLLMQARWFHILGMMMFIWSSAHQYKCHVILGNLRKNKAGVVIHCNH RIPFGDWFEYVSSPNYLAELMIYVSMAVTFGFHNLTWWLVVTNVFFNQALSAFLSHQFYK SKFVSYPKHRKAFLPFLF |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
MOB1/phocein family
|
|||||
| Function |
Activator of LATS1/2 in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Stimulates the kinase activity of STK38 and STK38L. Acts cooperatively with STK3/MST2 to activate STK38.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
TH211 Probe Info |
![]() |
Y26(5.64) | LDD0257 | [1] | |
|
TH216 Probe Info |
![]() |
Y95(16.31) | LDD0259 | [1] | |
|
STPyne Probe Info |
![]() |
K16(5.56); K30(0.79) | LDD0277 | [2] | |
|
BTD Probe Info |
![]() |
C109(0.73) | LDD2089 | [3] | |
|
HHS-465 Probe Info |
![]() |
Y95(10.00) | LDD2237 | [4] | |
|
AOyne Probe Info |
![]() |
6.90 | LDD0443 | [5] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0548 | 1-(4-(Benzo[d][1,3]dioxol-5-ylmethyl)piperazin-1-yl)-2-nitroethan-1-one | MDA-MB-231 | C109(0.84) | LDD2142 | [3] |
| LDCM0502 | 1-(Cyanoacetyl)piperidine | MDA-MB-231 | C109(0.87) | LDD2095 | [3] |
| LDCM0524 | 2-Cyano-N-(2-morpholin-4-yl-ethyl)-acetamide | MDA-MB-231 | C109(1.52) | LDD2117 | [3] |
| LDCM0539 | 3-(4-Isopropylpiperazin-1-yl)-3-oxopropanenitrile | MDA-MB-231 | C109(0.95) | LDD2132 | [3] |
| LDCM0498 | BS-3668 | MDA-MB-231 | C109(0.37) | LDD2091 | [3] |
| LDCM0528 | N-(4-bromophenyl)-2-cyano-N-phenylacetamide | MDA-MB-231 | C109(0.75) | LDD2121 | [3] |
| LDCM0496 | Nucleophilic fragment 11a | MDA-MB-231 | C109(0.73) | LDD2089 | [3] |
| LDCM0501 | Nucleophilic fragment 13b | MDA-MB-231 | C109(1.36) | LDD2094 | [3] |
| LDCM0503 | Nucleophilic fragment 14b | MDA-MB-231 | C109(0.76) | LDD2096 | [3] |
| LDCM0516 | Nucleophilic fragment 21a | MDA-MB-231 | C109(1.01) | LDD2109 | [3] |
| LDCM0522 | Nucleophilic fragment 24a | MDA-MB-231 | C109(0.62) | LDD2115 | [3] |
| LDCM0523 | Nucleophilic fragment 24b | MDA-MB-231 | C109(0.56) | LDD2116 | [3] |
| LDCM0525 | Nucleophilic fragment 25b | MDA-MB-231 | C109(0.76) | LDD2118 | [3] |
| LDCM0527 | Nucleophilic fragment 26b | MDA-MB-231 | C109(0.91) | LDD2120 | [3] |
| LDCM0529 | Nucleophilic fragment 27b | MDA-MB-231 | C109(0.53) | LDD2122 | [3] |
| LDCM0530 | Nucleophilic fragment 28a | MDA-MB-231 | C109(0.71) | LDD2123 | [3] |
| LDCM0531 | Nucleophilic fragment 28b | MDA-MB-231 | C109(0.47) | LDD2124 | [3] |
| LDCM0532 | Nucleophilic fragment 29a | MDA-MB-231 | C109(1.03) | LDD2125 | [3] |
| LDCM0534 | Nucleophilic fragment 30a | MDA-MB-231 | C109(1.27) | LDD2127 | [3] |
| LDCM0535 | Nucleophilic fragment 30b | MDA-MB-231 | C109(0.80) | LDD2128 | [3] |
| LDCM0541 | Nucleophilic fragment 36 | MDA-MB-231 | C109(1.02) | LDD2134 | [3] |
| LDCM0543 | Nucleophilic fragment 38 | MDA-MB-231 | C109(1.18) | LDD2136 | [3] |
| LDCM0544 | Nucleophilic fragment 39 | MDA-MB-231 | C109(1.10) | LDD2137 | [3] |
| LDCM0546 | Nucleophilic fragment 40 | MDA-MB-231 | C109(0.82) | LDD2140 | [3] |
| LDCM0547 | Nucleophilic fragment 41 | MDA-MB-231 | C109(0.30) | LDD2141 | [3] |
| LDCM0549 | Nucleophilic fragment 43 | MDA-MB-231 | C109(0.97) | LDD2143 | [3] |
| LDCM0555 | Nucleophilic fragment 7b | MDA-MB-231 | C109(0.81) | LDD2149 | [3] |
| LDCM0556 | Nucleophilic fragment 8a | MDA-MB-231 | C109(0.44) | LDD2150 | [3] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| WASH complex subunit 3 (WASHC3) | CCDC53 family | Q9Y3C0 | |||
Transcription factor
Cytokine and receptor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| CKLF-like MARVEL transmembrane domain-containing protein 3 (CMTM3) | Chemokine-like factor family | Q96MX0 | |||
Other
References






