Details of the Target

General Information of Target

Target ID LDTP12065
Target Name MOB kinase activator 1A (MOB1A)
Gene Name MOB1A
Gene ID 55233
Synonyms
C2orf6; MOB4B; MOBK1B; MOBKL1B; MOB kinase activator 1A; Mob1 alpha; Mob1A; Mob1 homolog 1B; Mps one binder kinase activator-like 1B
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAPWAEAEHSALNPLRAVWLTLTAAFLLTLLLQLLPPGLLPGCAIFQDLIRYGKTKCGEP
SRPAACRAFDVPKRYFSHFYIISVLWNGFLLWCLTQSLFLGAPFPSWLHGLLRILGAAQF
QGGELALSAFLVLVFLWLHSLRRLFECLYVSVFSNVMIHVVQYCFGLVYYVLVGLTVLSQ
VPMDGRNAYITGKNLLMQARWFHILGMMMFIWSSAHQYKCHVILGNLRKNKAGVVIHCNH
RIPFGDWFEYVSSPNYLAELMIYVSMAVTFGFHNLTWWLVVTNVFFNQALSAFLSHQFYK
SKFVSYPKHRKAFLPFLF
Target Bioclass
Other
Family
MOB1/phocein family
Function
Activator of LATS1/2 in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Stimulates the kinase activity of STK38 and STK38L. Acts cooperatively with STK3/MST2 to activate STK38.
Uniprot ID
Q9H8S9
Ensemble ID
ENST00000396049.5
HGNC ID
HGNC:16015

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HEC1 SNV: p.P106Q .
HEC1B SNV: p.P106Q .
L428 SNV: p.I208M .
MOLT4 SNV: p.R8H .
OCIAML5 Insertion: p.A44SfsTer6 .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 6 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
TH211
 Probe Info  		Y26(5.64)  LDD0257  [1]
TH216
 Probe Info  		Y95(16.31)  LDD0259  [1]
STPyne
 Probe Info  		K16(5.56); K30(0.79)  LDD0277  [2]
BTD
 Probe Info  		C109(0.73)  LDD2089  [3]
HHS-465
 Probe Info  		Y95(10.00)  LDD2237  [4]
AOyne
 Probe Info  		6.90  LDD0443  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0548  1-(4-(Benzo[d][1,3]dioxol-5-ylmethyl)piperazin-1-yl)-2-nitroethan-1-one MDA-MB-231 C109(0.84)  LDD2142  [3]
 LDCM0502  1-(Cyanoacetyl)piperidine MDA-MB-231 C109(0.87)  LDD2095  [3]
 LDCM0524  2-Cyano-N-(2-morpholin-4-yl-ethyl)-acetamide MDA-MB-231 C109(1.52)  LDD2117  [3]
 LDCM0539  3-(4-Isopropylpiperazin-1-yl)-3-oxopropanenitrile MDA-MB-231 C109(0.95)  LDD2132  [3]
 LDCM0498  BS-3668 MDA-MB-231 C109(0.37)  LDD2091  [3]
 LDCM0528  N-(4-bromophenyl)-2-cyano-N-phenylacetamide MDA-MB-231 C109(0.75)  LDD2121  [3]
 LDCM0496  Nucleophilic fragment 11a MDA-MB-231 C109(0.73)  LDD2089  [3]
 LDCM0501  Nucleophilic fragment 13b MDA-MB-231 C109(1.36)  LDD2094  [3]
 LDCM0503  Nucleophilic fragment 14b MDA-MB-231 C109(0.76)  LDD2096  [3]
 LDCM0516  Nucleophilic fragment 21a MDA-MB-231 C109(1.01)  LDD2109  [3]
 LDCM0522  Nucleophilic fragment 24a MDA-MB-231 C109(0.62)  LDD2115  [3]
 LDCM0523  Nucleophilic fragment 24b MDA-MB-231 C109(0.56)  LDD2116  [3]
 LDCM0525  Nucleophilic fragment 25b MDA-MB-231 C109(0.76)  LDD2118  [3]
 LDCM0527  Nucleophilic fragment 26b MDA-MB-231 C109(0.91)  LDD2120  [3]
 LDCM0529  Nucleophilic fragment 27b MDA-MB-231 C109(0.53)  LDD2122  [3]
 LDCM0530  Nucleophilic fragment 28a MDA-MB-231 C109(0.71)  LDD2123  [3]
 LDCM0531  Nucleophilic fragment 28b MDA-MB-231 C109(0.47)  LDD2124  [3]
 LDCM0532  Nucleophilic fragment 29a MDA-MB-231 C109(1.03)  LDD2125  [3]
 LDCM0534  Nucleophilic fragment 30a MDA-MB-231 C109(1.27)  LDD2127  [3]
 LDCM0535  Nucleophilic fragment 30b MDA-MB-231 C109(0.80)  LDD2128  [3]
 LDCM0541  Nucleophilic fragment 36 MDA-MB-231 C109(1.02)  LDD2134  [3]
 LDCM0543  Nucleophilic fragment 38 MDA-MB-231 C109(1.18)  LDD2136  [3]
 LDCM0544  Nucleophilic fragment 39 MDA-MB-231 C109(1.10)  LDD2137  [3]
 LDCM0546  Nucleophilic fragment 40 MDA-MB-231 C109(0.82)  LDD2140  [3]
 LDCM0547  Nucleophilic fragment 41 MDA-MB-231 C109(0.30)  LDD2141  [3]
 LDCM0549  Nucleophilic fragment 43 MDA-MB-231 C109(0.97)  LDD2143  [3]
 LDCM0555  Nucleophilic fragment 7b MDA-MB-231 C109(0.81)  LDD2149  [3]
 LDCM0556  Nucleophilic fragment 8a MDA-MB-231 C109(0.44)  LDD2150  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Choline-phosphate cytidylyltransferase A (PCYT1A) Cytidylyltransferase family P49585
Serine/threonine-protein kinase 38 (STK38) AGC Ser/Thr protein kinase family Q15208
Serine/threonine-protein kinase 38-like (STK38L) AGC Ser/Thr protein kinase family Q9Y2H1
Serine/threonine-protein kinase LATS1 (LATS1) AGC Ser/Thr protein kinase family O95835
Serine/threonine-protein kinase LATS2 (LATS2) AGC Ser/Thr protein kinase family Q9NRM7
Serine/threonine-protein kinase 3 (STK3) STE Ser/Thr protein kinase family Q13188
Serine/threonine-protein kinase 4 (STK4) STE Ser/Thr protein kinase family Q13043
Neuronal-specific septin-3 (SEPTIN3) Septin GTPase family Q9UH03
E3 ubiquitin-protein ligase TRIM32 (TRIM32) TRIM/RBCC family Q13049
Tryptophan 2,3-dioxygenase (TDO2) Tryptophan 2,3-dioxygenase family P48775
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
WASH complex subunit 3 (WASHC3) CCDC53 family Q9Y3C0
Transcription factor
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein Eos (IKZF4) Ikaros C2H2-type zinc-finger protein family Q9H2S9
Leucine zipper transcription factor-like protein 1 (LZTFL1) LZTFL1 family Q9NQ48
Glucocorticoid modulatory element-binding protein 2 (GMEB2) . Q9UKD1
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
CKLF-like MARVEL transmembrane domain-containing protein 3 (CMTM3) Chemokine-like factor family Q96MX0
Other
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein FAM118A (FAM118A) FAM118 family Q9NWS6
Protein FAM9B (FAM9B) FAM9 family Q8IZU0
KxDL motif-containing protein 1 (KXD1) KXD1 family Q9BQD3
KN motif and ankyrin repeat domain-containing protein 2 (KANK2) . Q63ZY3
Transmembrane protein 190 (TMEM190) . Q8WZ59

References

1 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
2 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
3 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
4 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
5 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.