Details of the Target
General Information of Target
| Target ID | LDTP12045 | |||||
|---|---|---|---|---|---|---|
| Target Name | tRNA N(3)-methylcytidine methyltransferase METTL8, mitochondrial (METTL8) | |||||
| Gene Name | METTL8 | |||||
| Gene ID | 79828 | |||||
| Synonyms |
tRNA N(3)-methylcytidine methyltransferase METTL8, mitochondrial; EC 2.1.1.-; Methyltransferase-like protein 8; mRNA N(3)-methylcytidine methyltransferase METTL8; EC 2.1.1.- |
|||||
| 3D Structure | ||||||
| Sequence |
MNGVLIPHTPIAVDFWSLRRAGTARLFFLSHMHSDHTVGLSSTWARPLYCSPITAHLLHR
HLQVSKQWIQALEVGESHVLPLDEIGQETMTVTLLDANHCPGSVMFLFEGYFGTILYTGD FRYTPSMLKEPALTLGKQIHTLYLDNTNCNPALVLPSRQEAAHQIVQLIRKHPQHNIKIG LYSLGKESLLEQLALEFQTWVVLSPRRLELVQLLGLADVFTVEEKAGRIHAVDHMEICHS NMLRWNQTHPTIAILPTSRKIHSSHPDIHVIPYSDHSSYSELRAFVAALKPCQVVPIVSR RPCGGFQDSLSPRISVPLIPDSVQQYMSSSSRKPSLLWLLERRLKRPRTQGVVFESPEES ADQSQADRDSKKAKKEKLSPWPADLEKQPSHHPLRIKKQLFPDLYSKEWNKAVPFCESQK RVTMLTAPLGFSVHLRSTDEEFISQKTREEIGLGSPLVPMGDDDGGPEATGNQSAWMGHG SPLSHSSKGTPLLATEFRGLALKYLLTPVNFFQAGYSSRRFDQQVEKYHKPC |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Methyltransferase superfamily, METL family
|
|||||
| Subcellular location |
Mitochondrion
|
|||||
| Function |
Mitochondrial S-adenosyl-L-methionine-dependent methyltransferase that mediates N(3)-methylcytidine modification of residue 32 of the tRNA anticodon loop of mitochondrial tRNA(Ser)(UCN) and tRNA(Thr). N(3)-methylcytidine methylation modification regulates mitochondrial translation efficiency and is required for activity of the respiratory chain. N(3)-methylcytidine methylation of mitochondrial tRNA(Ser)(UCN) requires the formation of N(6)-dimethylallyladenosine(37) (i6A37) by TRIT1 as prerequisite. May also mediate N(3)-methylcytidine modification of mRNAs. The existence of N(3)-methylcytidine modification on mRNAs is however unclear, and additional evidences are required to confirm the role of the N(3)-methylcytidine-specific mRNA methyltransferase activity of METTL8 in vivo.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
![]() |
N.A. | LDD0241 | [1] | |
|
DBIA Probe Info |
![]() |
C96(2.07) | LDD3364 | [2] | |
|
AHL-Pu-1 Probe Info |
![]() |
C146(2.14) | LDD0171 | [3] | |
|
IA-alkyne Probe Info |
![]() |
C146(0.44) | LDD2183 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0026 | 4SU-RNA+native RNA | DM93 | C146(2.14) | LDD0171 | [3] |
| LDCM0576 | Fragment14 | Ramos | C146(0.25) | LDD2193 | [4] |
| LDCM0586 | Fragment28 | Ramos | C146(0.43) | LDD2198 | [4] |
| LDCM0566 | Fragment4 | Ramos | C146(1.76) | LDD2184 | [4] |
| LDCM0569 | Fragment7 | Ramos | C146(0.98) | LDD2186 | [4] |
| LDCM0022 | KB02 | AGS | C96(2.12) | LDD2263 | [2] |
| LDCM0023 | KB03 | Ramos | C146(0.44) | LDD2183 | [4] |
| LDCM0024 | KB05 | NCI-N87 | C96(2.07) | LDD3364 | [2] |
References




