Details of the Target
General Information of Target
| Target ID | LDTP12010 | |||||
|---|---|---|---|---|---|---|
| Target Name | Protein associated with UVRAG as autophagy enhancer (RUBCNL) | |||||
| Gene Name | RUBCNL | |||||
| Gene ID | 80183 | |||||
| Synonyms |
C13orf18; KIAA0226L; Protein associated with UVRAG as autophagy enhancer; Pacer; Protein Rubicon-like |
|||||
| 3D Structure | ||||||
| Sequence |
MAAAALRFPVQGTVTFEDVAVKFTQEEWNLLSEAQRCLYRDVTLENLALMSSLGCWCGVE
DEAAPSKQSIYIQRETQVRTPMAGVSPKKAHPCEMCGPILGDILHVADHQGTHHKQKLHR CEAWGNKLYDSGNFHQHQNEHIGEKPYRGSVEEALFAKRCKLHVSGESSVFSESGKDFLL RSGLLQQEATHTGKSNSKTECVSLFHGGKSHYSCGGCMKHFSTKDILSQHERLLPTEEPS VWCECGKSSSKYDSFSNHQGVHTREKPYTCGICGKLFNSKSHLLVHQRIHTGEKPYECEV CQKFFRHKYHLIAHQRVHTGERPYECSDCGKSFTHSSTFRVHKRVHTGQKPYECSECGKS FAESSSLTKHRRVHTGEKPYGCSECEKKFRQISSLRHHQRVHKRKGL |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasmic vesicle, autophagosome membrane
|
|||||
| Function |
Regulator of autophagy that promotes autophagosome maturation by facilitating the biogenesis of phosphatidylinositol 3-phosphate (PtdIns(3)P) in late steps of autophagy. Acts by antagonizing RUBCN, thereby stimulating phosphatidylinositol 3-kinase activity of the PI3K/PI3KC3 complex. Following anchorage to the autophagosomal SNARE STX17, promotes the recruitment of PI3K/PI3KC3 and HOPS complexes to the autophagosome to regulate the fusion specificity of autophagosomes with late endosomes/lysosomes. Binds phosphoinositides phosphatidylinositol 3-phosphate (PtdIns(3)P), 4-phosphate (PtdIns(4)P) and 5-phosphate (PtdIns(5)P). In addition to its role in autophagy, acts as a regulator of lipid and glycogen homeostasis. May act as a tumor suppressor (Probable).
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C764(3.54) | LDD3428 | [1] | |
|
IA-alkyne Probe Info |
 |
N.A. | LDD0166 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C40(1.69) | LDD2187 | [3] |
| LDCM0573 | Fragment11 | Ramos | C226(3.77) | LDD2190 | [3] |
| LDCM0574 | Fragment12 | Ramos | C40(1.11) | LDD2191 | [3] |
| LDCM0575 | Fragment13 | Ramos | C40(0.83) | LDD2192 | [3] |
| LDCM0576 | Fragment14 | Ramos | C40(1.15); C226(1.69) | LDD2193 | [3] |
| LDCM0580 | Fragment21 | Ramos | C40(0.86) | LDD2195 | [3] |
| LDCM0582 | Fragment23 | Ramos | C40(1.12) | LDD2196 | [3] |
| LDCM0578 | Fragment27 | Ramos | C40(0.88) | LDD2197 | [3] |
| LDCM0586 | Fragment28 | Ramos | C40(0.76) | LDD2198 | [3] |
| LDCM0588 | Fragment30 | Ramos | C40(1.32) | LDD2199 | [3] |
| LDCM0589 | Fragment31 | Ramos | C40(0.89) | LDD2200 | [3] |
| LDCM0468 | Fragment33 | Ramos | C40(1.45) | LDD2202 | [3] |
| LDCM0596 | Fragment38 | Ramos | C40(0.52) | LDD2203 | [3] |
| LDCM0566 | Fragment4 | Ramos | C40(1.07); C226(1.11) | LDD2184 | [3] |
| LDCM0610 | Fragment52 | Ramos | C40(0.99) | LDD2204 | [3] |
| LDCM0614 | Fragment56 | Ramos | C40(0.81) | LDD2205 | [3] |
| LDCM0569 | Fragment7 | Ramos | C226(0.99) | LDD2186 | [3] |
| LDCM0022 | KB02 | Ramos | C226(0.87) | LDD2182 | [3] |
| LDCM0023 | KB03 | Jurkat | C630,C641(6.82) | LDD0315 | [2] |
| LDCM0024 | KB05 | SK-MEL3 | C764(3.54) | LDD3428 | [1] |
The Interaction Atlas With This Target
References