Details of the Target
General Information of Target
Target ID | LDTP11731 | |||||
---|---|---|---|---|---|---|
Target Name | Ras-related protein Rab-17 (RAB17) | |||||
Gene Name | RAB17 | |||||
Gene ID | 64284 | |||||
Synonyms |
Ras-related protein Rab-17 |
|||||
3D Structure | ||||||
Sequence |
MAAPEEHDSPTEASQPIVEEEETKTFKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQ
GRDIIGLAETGSGKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIG VQSAVIVGGIDSMSQSLALAKKPHIIIATPGRLIDHLENTKGFNLRALKYLVMDEADRIL NMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKNPVKCAVSSKYQTVEKLQQ YYIFIPSKFKDTYLVYILNELAGNSFMIFCSTCNNTQRTALLLRNLGFTAIPLHGQMSQS KRLGSLNKFKAKARSILLATDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRS GKAITFVTQYDVELFQRIEHLIGKKLPGFPTQDDEVMMLTERVAEAQRFARMELREHGEK KKRSREDAGDNDDTEGAIGVRNKVAGGKMKKRKGR |
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
Small GTPase superfamily, Rab family
|
|||||
Subcellular location |
Recycling endosome membrane
|
|||||
Function |
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab is involved in transcytosis, the directed movement of endocytosed material through the cell and its exocytosis from the plasma membrane at the opposite side. Mainly observed in epithelial cells, transcytosis mediates for instance, the transcellular transport of immunoglobulins from the basolateral surface to the apical surface. Most probably controls membrane trafficking through apical recycling endosomes in a post-endocytic step of transcytosis. Required for melanosome transport and release from melanocytes, it also regulates dendrite and dendritic spine development. May also play a role in cell migration.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C53(1.59) | LDD3339 | [1] | |
AHL-Pu-1 Probe Info |
![]() |
C84(2.25) | LDD0171 | [2] | |
NAIA_5 Probe Info |
![]() |
C84(0.00); C53(0.00) | LDD2225 | [3] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0026 | 4SU-RNA+native RNA | DM93 | C84(2.25) | LDD0171 | [2] |
LDCM0020 | ARS-1620 | HCC44 | C53(1.03) | LDD2171 | [4] |
LDCM0632 | CL-Sc | Hep-G2 | C84(0.44); C53(0.34) | LDD2227 | [3] |
LDCM0022 | KB02 | 22RV1 | C53(3.43) | LDD2243 | [1] |
LDCM0023 | KB03 | 22RV1 | C53(4.31) | LDD2660 | [1] |
LDCM0024 | KB05 | NALM-6 | C53(1.59) | LDD3339 | [1] |
LDCM0021 | THZ1 | HCT 116 | C53(1.03) | LDD2173 | [4] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Other
References