Details of the Target

General Information of Target

Target ID LDTP11713
Target Name Enkurin domain-containing protein 1 (ENKD1)
Gene Name ENKD1
Gene ID 84080
Synonyms
C16orf48; Enkurin domain-containing protein 1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMK
AETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQLSEE
QKSALAFLNRGQPSSSNAGNKRLSTIDESGSILSDISFDKTDESLDWDSSLVKTFKLKKR
EKRRSTSRQFVDGPPGPVKKTRSIGSAVDQGNESIVAKTTVTVPNDGGPIEAVSTIETVP
YWTRSRRKTGTLQPWNSDSTLNSRQLEPRTETDSVGTPQSNGGMRLHDFVSKTVIKPESC
VPCGKRIKFGKLSLKCRDCRVVSHPECRDRCPLPCIPTLIGTPVKIGEGMLADFVSQTSP
MIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKTVPLLSKVDDIHAICS
LLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAMYQAVGELPQANRDTLAFLMIHL
QRVAQSPHTKMDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQPKVVERLLSLPLEYWS
QFMMVEQENIDPLHVIENSNAFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRS
TLTKNTPRFGSKSKSATNLGRQGNFFASPMLK
Target Bioclass
Other
Subcellular location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome
Function
Microtubule-binding protein which regulates microtubule organization and stability. Promotes the stability of astral microtubules and facilitates the proper orientation of the mitotic spindle. This allows the oriented division of basal keratinocytes and contributes to epidermal stratification. Required for the assembly of both primary and motile cilia. Destabilizes the interaction between CCP110 and CEP97 by competing with CEP97 for binding to CCP110 which promotes the removal of CCP110 and CEP97 from the mother centriole and allows the initiation of ciliogenesis.
Uniprot ID
Q9H0I2
Ensemble ID
ENST00000243878.9
HGNC ID
HGNC:25246

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
KNS42 SNV: p.L42S .
NB4 SNV: p.Q225E .
RKO SNV: p.P26S .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C58(0.84)  LDD1507  [1]
IPM
 Probe Info  		N.A.  LDD2156  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0214  AC1 HEK-293T C58(0.84)  LDD1507  [1]
 LDCM0270  AC15 HEK-293T C58(1.06)  LDD1513  [1]
 LDCM0276  AC17 HEK-293T C58(0.96)  LDD1515  [1]
 LDCM0281  AC21 HEK-293T C19(0.99)  LDD1520  [1]
 LDCM0283  AC23 HEK-293T C58(1.23)  LDD1522  [1]
 LDCM0285  AC25 HEK-293T C58(0.98)  LDD1524  [1]
 LDCM0289  AC29 HEK-293T C19(0.99)  LDD1528  [1]
 LDCM0292  AC31 HEK-293T C58(1.48)  LDD1531  [1]
 LDCM0294  AC33 HEK-293T C58(0.94)  LDD1533  [1]
 LDCM0298  AC37 HEK-293T C19(1.01)  LDD1537  [1]
 LDCM0300  AC39 HEK-293T C58(1.16)  LDD1539  [1]
 LDCM0303  AC41 HEK-293T C58(0.93)  LDD1542  [1]
 LDCM0307  AC45 HEK-293T C19(1.12)  LDD1546  [1]
 LDCM0309  AC47 HEK-293T C58(0.98)  LDD1548  [1]
 LDCM0311  AC49 HEK-293T C58(0.90)  LDD1550  [1]
 LDCM0312  AC5 HEK-293T C19(0.98)  LDD1551  [1]
 LDCM0316  AC53 HEK-293T C19(1.01)  LDD1555  [1]
 LDCM0318  AC55 HEK-293T C58(1.11)  LDD1557  [1]
 LDCM0320  AC57 HEK-293T C58(0.95)  LDD1559  [1]
 LDCM0325  AC61 HEK-293T C19(1.12)  LDD1564  [1]
 LDCM0327  AC63 HEK-293T C58(1.19)  LDD1566  [1]
 LDCM0334  AC7 HEK-293T C58(1.05)  LDD1568  [1]
 LDCM0248  AKOS034007472 HEK-293T C19(1.02)  LDD1511  [1]
 LDCM0356  AKOS034007680 HEK-293T C58(1.11)  LDD1570  [1]
 LDCM0371  CL102 HEK-293T C58(0.84)  LDD1575  [1]
 LDCM0372  CL103 HEK-293T C58(1.26)  LDD1576  [1]
 LDCM0375  CL106 HEK-293T C58(0.96)  LDD1579  [1]
 LDCM0376  CL107 HEK-293T C58(0.80)  LDD1580  [1]
 LDCM0379  CL11 HEK-293T C58(0.92)  LDD1583  [1]
 LDCM0380  CL110 HEK-293T C58(0.88)  LDD1584  [1]
 LDCM0381  CL111 HEK-293T C58(1.30)  LDD1585  [1]
 LDCM0384  CL114 HEK-293T C58(1.15)  LDD1588  [1]
 LDCM0385  CL115 HEK-293T C58(1.18)  LDD1589  [1]
 LDCM0388  CL118 HEK-293T C58(0.89)  LDD1592  [1]
 LDCM0389  CL119 HEK-293T C58(1.36)  LDD1593  [1]
 LDCM0393  CL122 HEK-293T C58(0.98)  LDD1597  [1]
 LDCM0394  CL123 HEK-293T C58(0.99)  LDD1598  [1]
 LDCM0397  CL126 HEK-293T C58(0.96)  LDD1601  [1]
 LDCM0398  CL127 HEK-293T C58(1.18)  LDD1602  [1]
 LDCM0401  CL14 HEK-293T C58(0.88)  LDD1605  [1]
 LDCM0402  CL15 HEK-293T C58(1.26)  LDD1606  [1]
 LDCM0404  CL17 HEK-293T C58(0.90)  LDD1608  [1]
 LDCM0407  CL2 HEK-293T C58(0.87)  LDD1611  [1]
 LDCM0409  CL21 HEK-293T C19(1.05)  LDD1613  [1]
 LDCM0411  CL23 HEK-293T C58(1.09)  LDD1615  [1]
 LDCM0414  CL26 HEK-293T C58(1.13)  LDD1618  [1]
 LDCM0415  CL27 HEK-293T C58(0.95)  LDD1619  [1]
 LDCM0417  CL29 HEK-293T C58(0.97)  LDD1621  [1]
 LDCM0418  CL3 HEK-293T C58(1.00)  LDD1622  [1]
 LDCM0422  CL33 HEK-293T C19(1.04)  LDD1626  [1]
 LDCM0424  CL35 HEK-293T C58(1.23)  LDD1628  [1]
 LDCM0428  CL39 HEK-293T C58(1.16)  LDD1632  [1]
 LDCM0431  CL41 HEK-293T C58(0.89)  LDD1635  [1]
 LDCM0435  CL45 HEK-293T C19(1.10)  LDD1639  [1]
 LDCM0437  CL47 HEK-293T C58(1.70)  LDD1641  [1]
 LDCM0440  CL5 HEK-293T C58(0.96)  LDD1644  [1]
 LDCM0441  CL50 HEK-293T C58(0.89)  LDD1645  [1]
 LDCM0444  CL53 HEK-293T C58(0.81)  LDD1647  [1]
 LDCM0448  CL57 HEK-293T C19(1.11)  LDD1651  [1]
 LDCM0450  CL59 HEK-293T C58(1.04)  LDD1653  [1]
 LDCM0454  CL62 HEK-293T C58(0.90)  LDD1657  [1]
 LDCM0455  CL63 HEK-293T C58(0.86)  LDD1658  [1]
 LDCM0457  CL65 HEK-293T C58(1.09)  LDD1660  [1]
 LDCM0461  CL69 HEK-293T C19(1.15)  LDD1664  [1]
 LDCM0464  CL71 HEK-293T C58(0.87)  LDD1667  [1]
 LDCM0467  CL74 HEK-293T C58(1.02)  LDD1670  [1]
 LDCM0470  CL77 HEK-293T C58(0.93)  LDD1673  [1]
 LDCM0475  CL81 HEK-293T C19(1.16)  LDD1678  [1]
 LDCM0477  CL83 HEK-293T C58(1.06)  LDD1680  [1]
 LDCM0480  CL86 HEK-293T C58(1.01)  LDD1683  [1]
 LDCM0481  CL87 HEK-293T C58(1.07)  LDD1684  [1]
 LDCM0483  CL89 HEK-293T C58(0.82)  LDD1686  [1]
 LDCM0484  CL9 HEK-293T C19(1.12)  LDD1687  [1]
 LDCM0488  CL93 HEK-293T C19(1.10)  LDD1691  [1]
 LDCM0490  CL95 HEK-293T C58(1.07)  LDD1693  [1]
 LDCM0493  CL98 HEK-293T C58(1.02)  LDD1696  [1]
 LDCM0494  CL99 HEK-293T C58(1.17)  LDD1697  [1]
 LDCM0495  E2913 HEK-293T C58(1.26)  LDD1698  [1]
 LDCM0468  Fragment33 HEK-293T C58(1.22)  LDD1671  [1]
 LDCM0427  Fragment51 HEK-293T C58(1.13)  LDD1631  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 23 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
PR domain zinc finger protein 14 (PRDM14) Class V-like SAM-binding methyltransferase superfamily Q9GZV8
Putative histone-lysine N-methyltransferase PRDM6 (PRDM6) Class V-like SAM-binding methyltransferase superfamily Q9NQX0
Histone-lysine N-methyltransferase SMYD3 (SMYD3) Histone-lysine methyltransferase family Q9H7B4
NADH dehydrogenase 1 beta subcomplex subunit 7 (NDUFB7) Complex I NDUFB7 subunit family P17568
DNA-directed RNA polymerase III subunit RPC3 (POLR3C) Eukaryotic RPC3/POLR3C RNA polymerase subunit family Q9BUI4
Cytochrome c oxidase assembly factor 7 (COA7) Hcp beta-lactamase family Q96BR5
Ubiquitin thioesterase ZRANB1 (ZRANB1) Peptidase C64 family Q9UGI0
Mitogen-activated protein kinase 9 (MAPK9) CMGC Ser/Thr protein kinase family P45984
Serine/threonine-protein kinase PAK 5 (PAK5) STE Ser/Thr protein kinase family Q9P286
Tensin-2 (TNS2) PTEN phosphatase protein family Q63HR2
RanBP-type and C3HC4-type zinc finger-containing protein 1 (RBCK1) RBR family Q9BYM8
E3 ubiquitin-protein ligase TRIM23 (TRIM23) Arf family P36406
SPRY domain-containing SOCS box protein 3 (SPSB3) SPSB family Q6PJ21
Arylsulfatase A (ARSA) Sulfatase family P15289
Terminal nucleotidyltransferase 5B (TENT5B) TENT family Q96A09
TNF receptor-associated factor 2 (TRAF2) TNF receptor-associated factor family Q12933
Zinc finger protein RFP (TRIM27) TRIM/RBCC family P14373
Fibronectin type III and SPRY domain-containing protein 2 (FSD2) . A1L4K1
Methyltransferase-like protein 27 (METTL27) . Q8N6F8
pre-mRNA splicing regulator USH1G (USH1G) . Q495M9
Probable E3 ubiquitin-protein ligase makorin-3 (MKRN3) . Q13064
Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma (PPP2R3C) . Q969Q6
Tripartite motif-containing protein 54 (TRIM54) . Q9BYV2
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Leucine zipper putative tumor suppressor 1 (LZTS1) LZTS family Q9Y250
Solute carrier family 15 member 2 (SLC15A2) Proton-dependent oligopeptide transporter (POT/PTR) (TC 2.A.17) family Q16348
MyoD family inhibitor (MDFI) MDFI family Q99750
Transcription factor
Click To Hide/Show 22 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-A1 (HOXA1) Antp homeobox family P49639
Protein c-Fos (FOS) BZIP family P01100
Protein FosB (FOSB) BZIP family P53539
SAM pointed domain-containing Ets transcription factor (SPDEF) ETS family O95238
Zinc finger protein 143 (ZNF143) GLI C2H2-type zinc-finger protein family P52747
G protein-coupled receptor associated sorting protein 3 (GPRASP3) GPRASP family Q6PI77
Zinc finger protein Aiolos (IKZF3) Ikaros C2H2-type zinc-finger protein family Q9UKT9
Zinc finger and BTB domain-containing protein 14 (ZBTB14) Krueppel C2H2-type zinc-finger protein family O43829
Zinc finger protein 436 (ZNF436) Krueppel C2H2-type zinc-finger protein family Q9C0F3
Zinc finger protein 511 (ZNF511) Krueppel C2H2-type zinc-finger protein family Q8NB15
Zinc finger protein 76 (ZNF76) Krueppel C2H2-type zinc-finger protein family P36508
Zinc finger protein 774 (ZNF774) Krueppel C2H2-type zinc-finger protein family Q6NX45
Zinc finger protein 90 homolog (ZFP90) Krueppel C2H2-type zinc-finger protein family Q8TF47
NF-kappa-B inhibitor alpha (NFKBIA) NF-kappa-B inhibitor family P25963
Homeobox protein PKNOX2 (PKNOX2) TALE/MEIS homeobox family Q96KN3
DNA-binding protein inhibitor ID-2 (ID2) . Q02363
Golgin-45 (BLZF1) . Q9H2G9
HMG domain-containing protein 4 (HMGXB4) . Q9UGU5
Homeobox-containing protein 1 (HMBOX1) . Q6NT76
Myogenic factor 5 (MYF5) . P13349
Zinc finger protein 426 (ZNF426) . Q9BUY5
Zinc finger protein 581 (ZNF581) . Q9P0T4
Other
Click To Hide/Show 112 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
A-kinase anchor protein 8-like (AKAP8L) AKAP95 family Q9ULX6
Large ribosomal subunit protein bL28m (MRPL28) Bacterial ribosomal protein bL28 family Q13084
Protein BEX3 (BEX3) BEX family Q00994
Calcium-binding and coiled-coil domain-containing protein 1 (CALCOCO1) CALCOCO family Q9P1Z2
Calcium-binding and coiled-coil domain-containing protein 2 (CALCOCO2) CALCOCO family Q13137
Cysteine-rich DPF motif domain-containing protein 1 (CDPF1) CDPF1 family Q6NVV7
Cerebellar degeneration-related protein 2 (CDR2) CDR2 family Q01850
Protein chibby homolog 1 (CBY1) Chibby family Q9Y3M2
Protein chibby homolog 2 (CBY2) Chibby family Q8NA61
Cysteine-rich hydrophobic domain-containing protein 2 (CHIC2) CHIC family Q9UKJ5
Reticulocalbin-1 (RCN1) CREC family Q15293
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
DNA mismatch repair protein Mlh1 (MLH1) DNA mismatch repair MutL/HexB family P40692
DPY30 domain-containing protein 1 (DYDC1) Dpy-30 family Q8WWB3
Early estrogen-induced gene 1 protein (EEIG1) EEIG family Q5T9C2
Protein FAM228A (FAM228A) FAM228 family Q86W67
Protein FAM90A1 (FAM90A1) FAM90 family Q86YD7
Inactive peptidyl-prolyl cis-trans isomerase FKBP6 (FKBP6) FKBP6 family O75344
Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G) GADD45 family O95257
Golgi to ER traffic protein 4 homolog (GET4) GET4 family Q7L5D6
GRB10-interacting GYF protein 1 (GIGYF1) GIGYF family O75420
Golgin subfamily A member 2 (GOLGA2) GOLGA2 family Q08379
Golgin subfamily A member 6-like protein 9 (GOLGA6L9) GOLGA6 family A6NEM1
Golgin subfamily A member 6A (GOLGA6A) GOLGA6 family Q9NYA3
Glial fibrillary acidic protein (GFAP) Intermediate filament family P14136
Keratin, type I cuticular Ha1 (KRT31) Intermediate filament family Q15323
Keratin, type I cuticular Ha5 (KRT35) Intermediate filament family Q92764
Keratin, type I cytoskeletal 14 (KRT14) Intermediate filament family P02533
Keratin, type I cytoskeletal 15 (KRT15) Intermediate filament family P19012
Keratin, type I cytoskeletal 40 (KRT40) Intermediate filament family Q6A162
Janus kinase and microtubule-interacting protein 1 (JAKMIP1) JAKMIP family Q96N16
Oocyte-expressed protein homolog (OOEP) KHDC1 family A6NGQ2
Keratin-associated protein 10-5 (KRTAP10-5) KRTAP type 10 family P60370
Keratin-associated protein 10-8 (KRTAP10-8) KRTAP type 10 family P60410
Keratin-associated protein 12-1 (KRTAP12-1) KRTAP type 12 family P59990
Keratin-associated protein 19-1 (KRTAP19-1) KRTAP type 19 family Q8IUB9
Keratin-associated protein 19-5 (KRTAP19-5) KRTAP type 19 family Q3LI72
Keratin-associated protein 19-6 (KRTAP19-6) KRTAP type 19 family Q3LI70
Keratin-associated protein 4-11 (KRTAP4-11) KRTAP type 4 family Q9BYQ6
Keratin-associated protein 5-9 (KRTAP5-9) KRTAP type 5 family P26371
Keratin-associated protein 6-2 (KRTAP6-2) KRTAP type 6 family Q3LI66
Protein LDOC1 (LDOC1) LDOC1 family O95751
Protein lin-7 homolog B (LIN7B) Lin-7 family Q9HAP6
Harmonin-binding protein USHBP1 (USHBP1) MCC family Q8N6Y0
LRP chaperone MESD (MESD) MESD family Q14696
MICOS complex subunit MIC19 (CHCHD3) MICOS complex subunit Mic19 family Q9NX63
Mitotic interactor and substrate of PLK1 (MISP) MISP family Q8IVT2
Large ribosomal subunit protein mL64 (GADD45GIP1) Mitochondrion-specific ribosomal protein mL64 family Q8TAE8
MRN complex-interacting protein (MRNIP) MRNIP family Q6NTE8
Myozenin-3 (MYOZ3) Myozenin family Q8TDC0
NEDD4-binding protein 3 (N4BP3) N4BP3 family O15049
NGFI-A-binding protein 2 (NAB2) NAB family Q15742
Alpha-parvin (PARVA) Parvin family Q9NVD7
Large ribosomal subunit protein mL38 (MRPL38) Phosphatidylethanolamine-binding protein family Q96DV4
Phosphatidylinositol 3-kinase regulatory subunit gamma (PIK3R3) PI3K p85 subunit family Q92569
PIH1 domain-containing protein 2 (PIH1D2) PIH1 family Q8WWB5
Keratin-associated protein 11-1 (KRTAP11-1) PMG family Q8IUC1
Keratin-associated protein 13-2 (KRTAP13-2) PMG family Q52LG2
Paraneoplastic antigen Ma1 (PNMA1) PNMA family Q8ND90
Paraneoplastic antigen Ma2 (PNMA2) PNMA family Q9UL42
Prefoldin subunit 3 (VBP1) Prefoldin subunit alpha family P61758
tRNA-splicing endonuclease subunit Sen15 (TSEN15) SEN15 family Q8WW01
Heat shock protein beta-2 (HSPB2) Small heat shock protein (HSP20) family Q16082
Pre-mRNA-splicing factor SPF27 (BCAS2) SPF27 family O75934
Stathmin-3 (STMN3) Stathmin family Q9NZ72
Troponin I, slow skeletal muscle (TNNI1) Troponin I family P19237
Vacuolar protein sorting-associated protein 37B (VPS37B) VPS37 family Q9H9H4
Ankyrin repeat domain-containing protein 23 (ANKRD23) . Q86SG2
Ankyrin repeat domain-containing protein 49 (ANKRD49) . Q8WVL7
Arginine vasopressin-induced protein 1 (AVPI1) . Q5T686
Armadillo repeat-containing protein 5 (ARMC5) . Q96C12
Brain-enriched guanylate kinase-associated protein (BEGAIN) . Q9BUH8
BRCA1-associated ATM activator 1 (BRAT1) . Q6PJG6
Brorin (VWC2) . Q2TAL6
Cell division cycle-associated protein 4 (CDCA4) . Q9BXL8
Centrosomal protein of 55 kDa (CEP55) . Q53EZ4
Centrosomal protein of 70 kDa (CEP70) . Q8NHQ1
Coiled-coil domain-containing protein 102B (CCDC102B) . Q68D86
Coiled-coil domain-containing protein 13 (CCDC13) . Q8IYE1
EF-hand domain-containing family member C2 (EFHC2) . Q5JST6
Extracellular matrix protein 1 (ECM1) . Q16610
EZH inhibitory protein (EZHIP) . Q86X51
Fibrinogen silencer-binding protein (FSBP) . O95073
GRIP1-associated protein 1 (GRIPAP1) . Q4V328
Heat shock factor 2-binding protein (HSF2BP) . O75031
Heterogeneous nuclear ribonucleoprotein H (HNRNPH1) . P31943
Insulin-like growth factor-binding protein 6 (IGFBP6) . P24592
Kelch-like protein 26 (KLHL26) . Q53HC5
Leucine rich adaptor protein 1 (LURAP1) . Q96LR2
Leucine-rich repeat-containing protein 61 (LRRC61) . Q9BV99
Lung adenoma susceptibility protein 2 (LAS2) . Q8IYD9
Mirror-image polydactyly gene 1 protein (MIPOL1) . Q8TD10
MORN repeat-containing protein 3 (MORN3) . Q6PF18
MORN repeat-containing protein 5 (MORN5) . Q5VZ52
NF-kappa-B essential modulator (IKBKG) . Q9Y6K9
NHL-repeat-containing protein 4 (NHLRC4) . P0CG21
PDZ and LIM domain protein 7 (PDLIM7) . Q9NR12
Polyhomeotic-like protein 2 (PHC2) . Q8IXK0
PRKCA-binding protein (PICK1) . Q9NRD5
Protein hinderin (KIAA1328) . Q86T90
Run domain Beclin-1-interacting and cysteine-rich domain-containing protein (RUBCN) . Q92622
SERTA domain-containing protein 3 (SERTAD3) . Q9UJW9
SH3 and cysteine-rich domain-containing protein 3 (STAC3) . Q96MF2
Spermatogenesis-associated protein 46 (SPATA46) . Q5T0L3
Splicing regulator RBM11 (RBM11) . P57052
Testican-2 (SPOCK2) . Q92563
TNF receptor-associated factor 1 (TRAF1) . Q13077
U11/U12 small nuclear ribonucleoprotein 48 kDa protein (SNRNP48) . Q6IEG0
UBX domain-containing protein 11 (UBXN11) . Q5T124
Uncharacterized protein C1orf105 (C1orf105) . O95561
Vinexin (SORBS3) . O60504
WD repeat-containing protein 62 (WDR62) . O43379

References

1 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
2 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019