Details of the Target

General Information of Target

Target ID LDTP11666
Target Name Single-stranded DNA cytosine deaminase (AICDA)
Gene Name AICDA
Gene ID 57379
Synonyms
AID; Single-stranded DNA cytosine deaminase; EC 3.5.4.38; Activation-induced cytidine deaminase; AID; Cytidine aminohydrolase
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLA
KEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVP
FLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Target Type
Clinical trial
Target Bioclass
Enzyme
Family
Cytidine and deoxycytidylate deaminase family
Subcellular location
Nucleus
Function
Single-stranded DNA-specific cytidine deaminase. Involved in somatic hypermutation (SHM), gene conversion, and class-switch recombination (CSR) in B-lymphocytes by deaminating C to U during transcription of Ig-variable (V) and Ig-switch (S) region DNA. Required for several crucial steps of B-cell terminal differentiation necessary for efficient antibody responses. May also play a role in the epigenetic regulation of gene expression by participating in DNA demethylation.
TTD ID
T36467
Uniprot ID
Q9GZX7
DrugMap ID
TTKRTP6
Ensemble ID
ENST00000229335.11
HGNC ID
HGNC:13203

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
CHL1 SNV: p.L59F .
HEC1 SNV: p.R74H .
HEC1B SNV: p.R74H .
MDAMB231 Deletion: p.W68_D69del .
ONS76 SNV: p.A132D .
PF382 SNV: p.A111V .
RKO SNV: p.H56Y .
SW1116 SNV: p.C55W .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C30(3.48); C116(3.66)  LDD3372  [1]
IA-alkyne
 Probe Info  		C116(0.91); C30(0.43); C55(0.77); 1.42  LDD2182  [2]
Acrolein
 Probe Info  		N.A.  LDD0224  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0625  F8 Ramos C116(2.03); C30(0.64); C55(1.91)  LDD2187  [2]
 LDCM0572  Fragment10 Ramos C116(0.54); C30(0.52)  LDD2189  [2]
 LDCM0573  Fragment11 Ramos C116(0.05); 0.26  LDD2190  [2]
 LDCM0574  Fragment12 Ramos C116(0.98); C30(0.72)  LDD2191  [2]
 LDCM0575  Fragment13 Ramos C116(1.07); C30(0.63)  LDD2192  [2]
 LDCM0576  Fragment14 Ramos C116(0.84); C30(0.66); C55(1.07)  LDD2193  [2]
 LDCM0579  Fragment20 Ramos C116(0.57); C30(0.65)  LDD2194  [2]
 LDCM0580  Fragment21 Ramos C116(1.24); C30(0.76)  LDD2195  [2]
 LDCM0582  Fragment23 Ramos C116(0.42); C30(0.73)  LDD2196  [2]
 LDCM0578  Fragment27 Ramos C116(1.28); C30(0.73)  LDD2197  [2]
 LDCM0586  Fragment28 Ramos C116(0.81); C30(0.67)  LDD2198  [2]
 LDCM0588  Fragment30 Ramos C116(0.72); C30(0.61)  LDD2199  [2]
 LDCM0589  Fragment31 Ramos C116(0.99); C30(0.85)  LDD2200  [2]
 LDCM0590  Fragment32 Ramos C30(0.34)  LDD2201  [2]
 LDCM0468  Fragment33 Ramos C116(1.34); C30(0.47)  LDD2202  [2]
 LDCM0596  Fragment38 Ramos C116(0.80); C30(0.46)  LDD2203  [2]
 LDCM0566  Fragment4 Ramos C116(0.46); C30(0.72); C55(1.09)  LDD2184  [2]
 LDCM0610  Fragment52 Ramos C116(1.13); C30(0.54)  LDD2204  [2]
 LDCM0614  Fragment56 Ramos C116(0.85); C30(0.70)  LDD2205  [2]
 LDCM0569  Fragment7 Ramos C116(1.12); C30(0.58); C55(1.10)  LDD2186  [2]
 LDCM0571  Fragment9 Ramos C116(0.61); C30(0.83)  LDD2188  [2]
 LDCM0022  KB02 Ramos C116(0.91); C30(0.43); C55(0.77); 1.42  LDD2182  [2]
 LDCM0023  KB03 Ramos C116(0.82); C30(0.85); C55(0.57); 1.06  LDD2183  [2]
 LDCM0024  KB05 OCI-Ly3 C30(3.48); C116(3.66)  LDD3372  [1]
 LDCM0109  NEM HeLa N.A.  LDD0224  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Single-stranded DNA cytosine deaminase (AICDA) Cytidine and deoxycytidylate deaminase family Q9GZX7
Heat shock cognate 71 kDa protein (HSPA8) Heat shock protein 70 family P11142
cAMP-dependent protein kinase catalytic subunit alpha (PRKACA) AGC Ser/Thr protein kinase family P17612
G/T mismatch-specific thymine DNA glycosylase (TDG) TDG/mug family Q13569
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Importin subunit alpha-4 (KPNA3) Importin alpha family O00505
Importin subunit alpha-5 (KPNA1) Importin alpha family P52294
Importin subunit alpha-6 (KPNA5) Importin alpha family O15131
Other
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
cAMP-dependent protein kinase type I-alpha regulatory subunit (PRKAR1A) CAMP-dependent kinase regulatory chain family P10644
Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A) GADD45 family P24522
DnaJ homolog subfamily A member 1 (DNAJA1) . P31689
DnaJ homolog subfamily A member 2 (DNAJA2) . O60884

The Drug(s) Related To This Target

Phase 1
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Jx-929 . D0H2YY

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
3 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.