General Information of Target

Target ID LDTP11351
Target Name RNA-binding protein 24 (RBM24)
Gene Name RBM24
Gene ID 221662
Synonyms
RNPC6; RNA-binding protein 24; RNA-binding motif protein 24; RNA-binding region-containing protein 6
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSGSSGTPYLGSKISLISKAQIRYEGILYTIDTDNSTVALAKVRSFGTEDRPTDRPAPPR
EEIYEYIIFRGSDIKDITVCEPPKAQHTLPQDPAIVQSSLGSASASPFQPHVPYSPFRGM
APYGPLAASSLLSQQYAASLGLGAGFPSIPVGKSPMVEQAVQTGSADNLNAKKLLPGKGT
TGTQLNGRQAQPSSKTASDVVQPAAVQAQGQVNDENRRPQRRRSGNRRTRNRSRGQNRPT
NVKENTIKFEGDFDFESANAQFNREELDKEFKKKLNFKDDKAEKGEEKDLAVVTQSAEAP
AEEDLLGPNCYYDKSKSFFDNISSELKTSSRRTTWAEERKLNTETFGVSGRFLRGRSSRG
GFRGGRGNGTTRRNPTSHRAGTGRV
Target Bioclass
Other
Subcellular location
Nucleus
Function
Multifunctional RNA-binding protein involved in the regulation of pre-mRNA splicing, mRNA stability and mRNA translation important for cell fate decision and differentiation. Plays a major role in pre-mRNA alternative splicing regulation. Mediates preferentially muscle-specific exon inclusion in numerous mRNAs important for striated cardiac and skeletal muscle cell differentiation. Binds to intronic splicing enhancer (ISE) composed of stretches of GU-rich motifs localized in flanking intron of exon that will be included by alternative splicing. Involved in embryonic stem cell (ESC) transition to cardiac cell differentiation by promoting pre-mRNA alternative splicing events of several pluripotency and/or differentiation genes. Plays a role in the regulation of mRNA stability. Binds to 3'-untranslated region (UTR) AU-rich elements in target transcripts, such as CDKN1A and MYOG, leading to maintain their stabilities. Involved in myogenic differentiation by regulating MYOG levels. Binds to multiple regions in the mRNA 3'-UTR of TP63 isoform 2, hence inducing its destabilization. Promotes also the destabilization of the CHRM2 mRNA via its binding to a region in the coding sequence. Plays a role in the regulation of mRNA translation. Mediates repression of p53/TP53 mRNA translation through its binding to U-rich element in the 3'-UTR, hence preventing EIF4E from binding to p53/TP53 mRNA and translation initiation. Binds to a huge amount of mRNAs. Required for embryonic heart development, sarcomer and M-band formation in striated muscles. Together with RBM20, promotes the expression of short isoforms of PDLIM5/ENH in cardiomyocytes.; (Microbial infection) Promotes hepatitis C virus (HCV) replication over translation through the inhibition of viral protein expression. Decreases viral translation by linking viral 5'- and 3'-UTRs, blocking 80S ribosome assembly on the viral IRES and enhancing the interaction of the mature core protein and 5'-UTR.
Uniprot ID
Q9BX46
Ensemble ID
ENST00000318204.5
HGNC ID
HGNC:21539

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
22RV1 Deletion: p.L18CfsTer66 .
CCK81 SNV: p.Y173C .
MEWO SNV: p.P124S .
MOLT4 SNV: p.T22P .
NCIH358 SNV: p.Q129K .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
BTD
 Probe Info 
C69(1.08)  LDD2099  [1]
m-APA
 Probe Info 
N.A.  LDD2231  [2]
IA-alkyne
 Probe Info 
N.A.  LDD0036  [3]
HHS-482
 Probe Info 
Y54(1.33)  LDD2239  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0524  2-Cyano-N-(2-morpholin-4-yl-ethyl)-acetamide MDA-MB-231 C69(0.85)  LDD2117  [1]
 LDCM0520  AKOS000195272 MDA-MB-231 C69(0.90)  LDD2113  [1]
 LDCM0506  Nucleophilic fragment 16a MDA-MB-231 C69(1.08)  LDD2099  [1]
 LDCM0508  Nucleophilic fragment 17a MDA-MB-231 C69(0.94)  LDD2101  [1]
 LDCM0516  Nucleophilic fragment 21a MDA-MB-231 C69(0.83)  LDD2109  [1]
 LDCM0522  Nucleophilic fragment 24a MDA-MB-231 C69(0.52)  LDD2115  [1]
 LDCM0530  Nucleophilic fragment 28a MDA-MB-231 C69(0.86)  LDD2123  [1]
 LDCM0533  Nucleophilic fragment 29b MDA-MB-231 C69(0.58)  LDD2126  [1]
 LDCM0534  Nucleophilic fragment 30a MDA-MB-231 C69(0.90)  LDD2127  [1]
 LDCM0535  Nucleophilic fragment 30b MDA-MB-231 C69(0.91)  LDD2128  [1]
 LDCM0544  Nucleophilic fragment 39 MDA-MB-231 C69(1.13)  LDD2137  [1]
 LDCM0553  Nucleophilic fragment 6b MDA-MB-231 C69(0.76)  LDD2147  [1]
 LDCM0554  Nucleophilic fragment 7a MDA-MB-231 C69(0.49)  LDD2148  [1]

References

1 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
2 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
3 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
4 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.