Details of the Target

General Information of Target

Target ID LDTP11306
Target Name Transmembrane protein 106C (TMEM106C)
Gene Name TMEM106C
Gene ID 79022
Synonyms
EMOC; Transmembrane protein 106C; Endoplasmic reticulum membrane protein overexpressed in cancer
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MLEPQENGVIDLPDYEHVEDETFPPFPPPASPERQDGEGTEPDEESGNGAPVRVPPKRTV
KRNIPKLDAQRLISERGLPALRHVFDKAKFKGKGHEAEDLKMLIRHMEHWAHRLFPKLQF
EDFIDRVEYLGSKKEVQTCLKRIRLDLPILHEDFVSNNDEVAENNEHDVTSTELDPFLTN
LSESEMFASELSRSLTEEQQQRIERNKQLALERRQAKLLSNSQTLGNDMLMNTPRAHTVE
EVNTDEDQKEESNGLNEDILDNPCNDAIANTLNEEETLLDQSFKNVQQQLDATSRNITEA
R
Target Bioclass
Transporter and channel
Family
TMEM106 family
Subcellular location
Endoplasmic reticulum membrane
Uniprot ID
Q9BVX2
Ensemble ID
ENST00000256686.10
HGNC ID
HGNC:28775

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
A2780 SNV: p.D129E .
HEC1B SNV: p.A98T .
TC71 SNV: p.S48G .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
AHL-Pu-1
 Probe Info  		C51(3.35)  LDD0168  [1]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0025  4SU-RNA HEK-293T C51(3.35)  LDD0168  [1]
 LDCM0026  4SU-RNA+native RNA HEK-293T C51(5.05)  LDD0169  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Polyisoprenoid diphosphate/phosphate phosphohydrolase PLPP6 (PLPP6) PA-phosphatase related phosphoesterase family Q8IY26
Pepsin A-4 (PGA4) Peptidase A1 family P0DJD7
Fatty acid hydroxylase domain-containing protein 2 (FAXDC2) Sterol desaturase family Q96IV6
Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 1 (HACD1) Very long-chain fatty acids dehydratase HACD family B0YJ81
E3 ubiquitin-protein ligase MARCHF2 (MARCHF2) . Q9P0N8
Transporter and channel
Click To Hide/Show 12 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Novel acetylcholine receptor chaperone (TMEM35A) DoxX family Q53FP2
Myelin and lymphocyte protein (MAL) MAL family P21145
Myeloid-associated differentiation marker (MYADM) MAL family Q96S97
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 (BNIP3) NIP3 family Q12983
Cardiac phospholamban (PLN) Phospholamban family P26678
Tetraspanin-33 (TSPAN33) Tetraspanin (TM4SF) family Q86UF1
Transmembrane protein 106A (TMEM106A) TMEM106 family Q96A25
Transmembrane protein 106B (TMEM106B) TMEM106 family Q9NUM4
Transmembrane protein 218 (TMEM218) TMEM218 family A2RU14
Sigma intracellular receptor 2 (TMEM97) TMEM97/sigma-2 receptor family Q5BJF2
Uroplakin-2 (UPK2) Uroplakin-2 family O00526
Neurensin-1 (NRSN1) VMP family Q8IZ57
Cytokine and receptor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
CKLF-like MARVEL transmembrane domain-containing protein 7 (CMTM7) Chemokine-like factor family Q96FZ5
C-X-C motif chemokine 9 (CXCL9) Intercrine alpha (chemokine CxC) family Q07325
Other
Click To Hide/Show 18 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cortexin-3 (CTXN3) Cortexin family Q4LDR2
Golgi SNAP receptor complex member 2 (GOSR2) GOSR2 family O14653
Keratin, type I cuticular Ha1 (KRT31) Intermediate filament family Q15323
Protein jagunal homolog 1 (JAGN1) Jagunal family Q8N5M9
Protein NKG7 (NKG7) PMP-22/EMP/MP20 family Q16617
Stress-associated endoplasmic reticulum protein 2 (SERP2) RAMP4 family Q8N6R1
Protein reprimo (RPRM) Reprimo family Q9NS64
Small cell adhesion glycoprotein (SMAGP) SMAGP family Q0VAQ4
Vesicle-associated membrane protein 5 (VAMP5) Synaptobrevin family O95183
Vesicle-trafficking protein SEC22a (SEC22A) Synaptobrevin family Q96IW7
Transmembrane protein 11, mitochondrial (TMEM11) TMEM11 family P17152
Protein YIPF6 (YIPF6) YIP1 family Q96EC8
Zinc finger protein-like 1 (ZFPL1) ZFPL1 family O95159
Epididymal secretory protein E3-beta (EDDM3B) . P56851
Insulin-like growth factor-binding protein 5 (IGFBP5) . P24593
Nutritionally-regulated adipose and cardiac enriched protein homolog (NRAC) . Q8N912
Pituitary tumor-transforming gene 1 protein-interacting protein (PTTG1IP) . P53801
Pulmonary surfactant-associated protein C (SFTPC) . P11686

References

1 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625