Details of the Target

General Information of Target

Target ID LDTP11257
Target Name Zinc finger protein 426 (ZNF426)
Gene Name ZNF426
Gene ID 79088
Synonyms
Zinc finger protein 426
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MKQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGY
SRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGG
YDTKEVTFYPQDAPDQPLKALAYVATPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLL
RLADFMQLCGPQAQDEHLAAIVDAVGTMLPCFCPTEQALALV
Target Bioclass
Transcription factor
Subcellular location
Nucleus
Function May be involved in transcriptional regulation.
Uniprot ID
Q9BUY5
Ensemble ID
ENST00000253115.7
HGNC ID
HGNC:20725

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
AHL-Pu-1
 Probe Info  		C310(2.31)  LDD0170  [1]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0025  4SU-RNA DM93 C310(2.31)  LDD0170  [1]
 LDCM0026  4SU-RNA+native RNA DM93 C310(2.25)  LDD0171  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Replication factor C subunit 5 (RFC5) Activator 1 small subunits family P40937
Metallophosphoesterase 1 (MPPE1) MPPE1 family Q53F39
Ubiquitin carboxyl-terminal hydrolase 25 (USP25) Peptidase C19 family Q9UHP3
Cyclin-dependent kinase 18 (CDK18) CMGC Ser/Thr protein kinase family Q07002
Dual specificity mitogen-activated protein kinase kinase 5 (MAP2K5) STE Ser/Thr protein kinase family Q13163
Dual specificity protein phosphatase 4 (DUSP4) Protein-tyrosine phosphatase family Q13115
Rho-related GTP-binding protein RhoJ (RHOJ) Rho family Q9H4E5
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
Glutaredoxin-3 (GLRX3) . O76003
LON peptidase N-terminal domain and RING finger protein 1 (LONRF1) . Q17RB8
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Gasdermin-D (GSDMD) Gasdermin family P57764
Optineurin (OPTN) . Q96CV9
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger and SCAN domain-containing protein 23 (ZSCAN23) Krueppel C2H2-type zinc-finger protein family Q3MJ62
Other
Click To Hide/Show 20 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Alpha-actinin-3 (ACTN3) Alpha-actinin family Q08043
ATP synthase mitochondrial F1 complex assembly factor 2 (ATPAF2) ATP12 family Q8N5M1
Bystin (BYSL) Bystin family Q13895
Testis-specific gene 10 protein (TSGA10) CEP135/TSGA10 family Q9BZW7
Cyclin-C (CCNC) Cyclin family P24863
Protein FAM161A (FAM161A) FAM161 family Q3B820
Protein HEXIM2 (HEXIM2) HEXIM family Q96MH2
Keratin, type II cytoskeletal 3 (KRT3) Intermediate filament family P12035
Mitochondrial assembly of ribosomal large subunit protein 1 (MALSU1) Iojap/RsfS family Q96EH3
Leucine zipper putative tumor suppressor 2 (LZTS2) LZTS2 family Q9BRK4
Protein mago nashi homolog 2 (MAGOHB) Mago nashi family Q96A72
Microtubule-associated tumor suppressor candidate 2 (MTUS2) MTUS1 family Q5JR59
Protein NATD1 (NATD1) NATD1 family Q8N6N6
Zinc finger protein 330 (ZNF330) NOA36 family Q9Y3S2
Gamma-parvin (PARVG) Parvin family Q9HBI0
Tektin-4 (TEKT4) Tektin family Q8WW24
Armadillo repeat-containing protein 7 (ARMC7) . Q9H6L4
BTB/POZ domain-containing protein KCTD9 (KCTD9) . Q7L273
Calcium and integrin-binding family member 3 (CIB3) . Q96Q77
Enkurin domain-containing protein 1 (ENKD1) . Q9H0I2

References

1 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625