Details of the Target
General Information of Target
Target ID | LDTP11208 | |||||
---|---|---|---|---|---|---|
Target Name | Mediator of RNA polymerase II transcription subunit 10 (MED10) | |||||
Gene Name | MED10 | |||||
Gene ID | 84246 | |||||
Synonyms |
Mediator of RNA polymerase II transcription subunit 10; Mediator complex subunit 10; Transformation-related gene 17 protein; TRG-17; Transformation-related gene 20 protein; TRG-20 |
|||||
3D Structure | ||||||
Sequence |
MEMKKKINLELRNRSPEEVTELVLDNCLCVNGEIEGLNDTFKELEFLSMANVELSSLARL
PSLNKLRKLELSDNIISGGLEVLAEKCPNLTYLNLSGNKIKDLSTVEALQNLKNLKSLDL FNCEITNLEDYRESIFELLQQITYLDGFDQEDNEAPDSEEEDDEDGDEDDEEEEENEAGP PEGYEEEEEEEEEEDEDEDEDEDEAGSELGEGEEEVGLSYLMKEEIQDEEDDDDYVEEGE EEEEEEEGGLRGEKRKRDAEDDGEEEDD |
|||||
Target Bioclass |
Other
|
|||||
Family |
Mediator complex subunit 10 family
|
|||||
Subcellular location |
Nucleus
|
|||||
Function |
Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
STPyne Probe Info |
![]() |
K106(7.08) | LDD0277 | [1] | |
m-APA Probe Info |
![]() |
N.A. | LDD2233 | [2] | |
IA-alkyne Probe Info |
![]() |
N.A. | LDD0162 | [3] | |
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [4] | |
IPM Probe Info |
![]() |
N.A. | LDD0147 | [5] | |
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [6] | |
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [4] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Tissue alpha-L-fucosidase (FUCA1) | Glycosyl hydrolase 29 family | P04066 |
Other
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Mediator of RNA polymerase II transcription subunit 7 (MED7) | Mediator complex subunit 7 family | O43513 | |||
Rho GDP-dissociation inhibitor 3 (ARHGDIG) | Rho GDI family | Q99819 |
References