Details of the Target

General Information of Target

Target ID LDTP11190
Target Name Trichoplein keratin filament-binding protein (TCHP)
Gene Name TCHP
Gene ID 84260
Synonyms
Trichoplein keratin filament-binding protein; Protein TCHP; Mitochondrial protein with oncostatic activity; Mitostatin; Tumor suppressor protein
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAEITNIRPSFDVSPVVAGLIGASVLVVCVSVTVFVWSCCHQQAEKKQKNPPYKFIHMLK
GISIYPETLSNKKKIIKVRRDKDGPGREGGRRNLLVDAAEAGLLSRDKDPRGPSSGSCID
QLPIKMDYGEELRSPITSLTPGESKTTSPSSPEEDVMLGSLTFSVDYNFPKKALVVTIQE
AHGLPVMDDQTQGSDPYIKMTILPDKRHRVKTRVLRKTLDPVFDETFTFYGIPYSQLQDL
VLHFLVLSFDRFSRDDVIGEVMVPLAGVDPSTGKVQLTRDIIKRNIQKCISRGELQVSLS
YQPVAQRMTVVVLKARHLPKMDITGLSGNPYVKVNVYYGRKRIAKKKTHVKKCTLNPIFN
ESFIYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTASGAEHWREVCESPRK
PVAKWHSLSEY
Target Bioclass
Other
Family
TCHP family
Subcellular location
Cytoplasm, cytoskeleton
Function
Tumor suppressor which has the ability to inhibit cell growth and be pro-apoptotic during cell stress. Inhibits cell growth in bladder and prostate cancer cells by a down-regulation of HSPB1 by inhibiting its phosphorylation. May act as a 'capping' or 'branching' protein for keratin filaments in the cell periphery. May regulate K8/K18 filament and desmosome organization mainly at the apical or peripheral regions of simple epithelial cells. Is a negative regulator of ciliogenesis.
Uniprot ID
Q9BT92
Ensemble ID
ENST00000312777.9
HGNC ID
HGNC:28135

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IPM
 Probe Info  		N.A.  LDD2156  [1]
PF-06672131
 Probe Info  		N.A.  LDD0017  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
NADPH-dependent diflavin oxidoreductase 1 (NDOR1) NADPH-dependent diflavin oxidoreductase NDOR1 family; Flavodoxin family; Flavoprotein pyridine nucleotide cytochrome reductase family Q9UHB4
Nucleoside diphosphate kinase homolog 7 (NME7) NDK family Q9Y5B8
Proteasome subunit beta type-5 (PSMB5) Peptidase T1B family P28074
Zinc finger protein RFP (TRIM27) TRIM/RBCC family P14373
Probable E3 ubiquitin-protein ligase makorin-3 (MKRN3) . Q13064
Tripartite motif-containing protein 54 (TRIM54) . Q9BYV2
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Eukaryotic translation initiation factor 4E transporter (EIF4ENIF1) 4E-T/EIF4E-T family Q9NRA8
Nucleoporin p54 (NUP54) NUP54 family Q7Z3B4
Transcription factor
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein Aiolos (IKZF3) Ikaros C2H2-type zinc-finger protein family Q9UKT9
Zinc finger imprinted 2 (ZIM2) Krueppel C2H2-type zinc-finger protein family Q9NZV7
DNA methyltransferase 1-associated protein 1 (DMAP1) . Q9NPF5
DNA-binding protein inhibitor ID-2 (ID2) . Q02363
High mobility group protein 20A (HMG20A) . Q9NP66
Other
Click To Hide/Show 27 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ATP synthase mitochondrial F1 complex assembly factor 2 (ATPAF2) ATP12 family Q8N5M1
Coiled-coil domain-containing protein 172 (CCDC172) CCDC172 family P0C7W6
Cerebellar degeneration-related protein 2 (CDR2) CDR2 family Q01850
Cerebellar degeneration-related protein 2-like (CDR2L) CDR2 family Q86X02
DPY30 domain-containing protein 1 (DYDC1) Dpy-30 family Q8WWB3
Keratin, type I cuticular Ha2 (KRT32) Intermediate filament family Q14532
Keratin, type I cuticular Ha4 (KRT34) Intermediate filament family O76011
Keratin, type I cuticular Ha5 (KRT35) Intermediate filament family Q92764
Keratin, type I cytoskeletal 15 (KRT15) Intermediate filament family P19012
Keratin, type I cytoskeletal 16 (KRT16) Intermediate filament family P08779
Keratin, type I cytoskeletal 19 (KRT19) Intermediate filament family P08727
Keratin, type I cytoskeletal 24 (KRT24) Intermediate filament family Q2M2I5
Keratin, type I cytoskeletal 40 (KRT40) Intermediate filament family Q6A162
Keratin, type II cytoskeletal 75 (KRT75) Intermediate filament family O95678
Leucine zipper putative tumor suppressor 2 (LZTS2) LZTS2 family Q9BRK4
Harmonin-binding protein USHBP1 (USHBP1) MCC family Q8N6Y0
NGFI-A-binding protein 2 (NAB2) NAB family Q15742
Pre-mRNA-splicing factor SPF27 (BCAS2) SPF27 family O75934
CST complex subunit STN1 (STN1) STN1 family Q9H668
AP-4 complex accessory subunit RUSC1 (RUSC1) . Q9BVN2
Brain-enriched guanylate kinase-associated protein (BEGAIN) . Q9BUH8
Coiled-coil domain-containing protein 125 (CCDC125) . Q86Z20
Coiled-coil domain-containing protein 13 (CCDC13) . Q8IYE1
Migration and invasion-inhibitory protein (MIIP) . Q5JXC2
Mirror-image polydactyly gene 1 protein (MIPOL1) . Q8TD10
Protein moonraker (KIAA0753) . Q2KHM9
Zinc finger matrin-type protein 5 (ZMAT5) . Q9UDW3

References

1 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019
2 Site-Specific Activity-Based Protein Profiling Using Phosphonate Handles. Mol Cell Proteomics. 2023 Jan;22(1):100455. doi: 10.1016/j.mcpro.2022.100455. Epub 2022 Nov 24.
Mass spectrometry data entry: PXD036569